Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5tugA_

Fold library idPDB HeaderMoleculeTitle
c5tugA_2.47PDB header: motor proteinChain: A: PDB Molecule: flagellar biosynthesis protein flag;


Added to library: Sat Jan 13 08:16:24 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MSSYSIQQSQKMLTQLQIDYATNTSSNTVVAYLHNVGETTISYLQNSVVYFGPNGQLQPVGYNSGSSPYW
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)



SS
SS




SSSSS
SSS

GGG
TT

T
SSSS
 .........80.........90.........100.........110.....
Sequence TVTSNSLQPGSVVKIIIYLSSPLSSNQYYTIQIVTPNGYTVSYMF
Predicted secondary structure















SS confidence












































Known secondary structure (DSSP) S
S
TT

SS


TT


TT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D