Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6zdfA_

Fold library idPDB HeaderMoleculeTitle
c6zdfA_3.00PDB header: hydrolaseChain: A: PDB Molecule: glycoprotein endo-alpha-1,2-mannosidase;


Added to library: Sat Nov 21 08:37:47 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LNNYLHVFYYSWYGNPQFDGKYIHWNHPVLEHWDPRIAKNYPQGRHNPPDDIGSSFYPELGSYSSRDPSV
Predicted secondary structure




























































SS confidence





































































Known secondary structure (DSSP)




B
TTTTSS
BSSS
B



SSTTS

SB

TTTS
SSSB
BTT
S

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence IETHMRQMRSASIGVLALSWYPPDVNDENGEPTDNLVPTILDKAHKYNLKVTFHIEPYSNRDDQNMYKNV
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TTT

TT


TTS


TTTT



TT

 .........150.........160.........170.........180.........190.........200.........210
Sequence KYIIDKYGNHPAFYRYKTKTGNALPMFYVYDSYITKPEKWANLLTTSGSRSIRNSPYDGLFIALLVEEKH
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TTSTTB

TTS
TTGGGS
STT
TT

TTSTT



STT
 .........220.........230.........240.........250.........260.........270.........280
Sequence KYDILQSGFDGIYTYFATNGFTYGSSHQNWASLKLFCDKYNLIFIPSVGPGYIDTSIRPWNTQNTRNRIN
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP) T
S


SSTTSSTTT
GGGTT


S
B

TTTSTTGGGG
B

GG
 .........290.........300.........310.........320.........330.........340.........350
Sequence GKYYEIGLSAALQTRPSLISITSFNEWHEGTQIEKAVPKRTSNTVYLDYRPHKPGLYLELTRKWSEKYSK
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) GTT

S
S
SS
TTTT


S
B


B
SS
B
B

TTS
TT
 ......
Sequence ERATYA
Predicted secondary structure





SS confidence





Known secondary structure (DSSP) TTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D