Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6vo8A_

Fold library idPDB HeaderMoleculeTitle
c6vo8A_2.40PDB header: oxidoreductaseChain: A: PDB Molecule: putative sugar-nucleotide epimerase/dehydratease;


Added to library: Sat Mar 28 10:06:16 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SKKVLITGGAGYIGSVLTPILLEKGYEVCVIDNLMFDQISLLSCFHNKNFTFINGDAMDENLIRQEVAKA
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

TTTSTTTT


TT


TTGGGTTSTT

TT
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence DIIIPLAALVGAPLCKRNPKLAKMINYEAVKMISDFASPSQIFIYPNTNSGYGIGEKDAMCTEESPLRPI
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) S

S

SSTS
TTS
TTBSTT
TT

TTS
B


 .........150.........160.........170.........180.........190.........200.........210
Sequence SEYGIDKVHAEQYLLDKGNCVTFRLATVFGISPRMRLDLLVNDFTYRAYRDKFIVLFEEHFRRNYIHVRD
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) STT


S

SS

SSSSSSTT
B

 .........220.........230.........240.........250.........260.........270.........280
Sequence VVKGFIHGIENYDKMKGQAYNMGLSSANLTKRQLAETIKKYIPDFYIHSANIGEDPDKRDYLVSNTKLEA
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TTT
S
TT


BTTSTT






TT





 .........290.........300...
Sequence TGWKPDNTLEDGIKELLRAFKMM
Predicted secondary structure









SS confidence






















Known secondary structure (DSSP) TT





TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D