Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6lbaC_

Fold library idPDB HeaderMoleculeTitle
c6lbaC_4.10PDB header: cytosolic proteinChain: C: PDB Molecule: protein kinase family protein;


Added to library: Sat Nov 21 11:22:54 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AAMEQFRQIGEVLGSLNALMVLQDDILINQRQCCLLLELFSLAFNTVAEEIRQNLKLEEKHTKWRALEQP
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP)
TS
TT
SS
SSSS
TT
TTTS
GGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence LRELTRVFKEGELYVKHCMDNSDWWGKVINLHQNKDCVEFHIHNLFCYFSAVVEAIEAAGLDPSEMERRR
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP)

S
STTS

TTTTTGGGS



 .........150.........160.........170.........180.........190.........200.........210
Sequence VVFSRKYDREWNDPKMFQWRFGKQYLLSRICSRFEHSWREDRWNLVEALQEKRKSDSKTEKRLADLLLKK
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) T
TT


TTTTTT



TTT



 .........220.........230.........240.........250.........260.........270.........280
Sequence LTFNGKLFPSSILLGSKDDLEPLSSEISSLLALCHSNILQELMHKDLQSYMKENRYLFSIPVVIDIMLQI
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) T






TTS








SS

GGGGGGGG


TTS




S

TT





 .........290.........300.........310.........320.........330.........340.........350
Sequence ARGMEYLHGNDIFHGDLNPMNIHLKERSHTEGYFHAKICGFGLSSVPVIWYAPEVLAEMKLTHKADVYSF
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTT






TTS



SSSSS




SSS




GGGS
SGGGTT



TTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence AMVCFELITGKVPFEMTINIRMGERPLFPFPSPKTLVSLIKRCWHSEPSQRPNFSSICRILRYIKKFLVV
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) SS
S


T





TTS
SS
STTS

S
 .........430.........440.........450.........460......
Sequence NPDHTPLVDCWDLEARFLRKFPGSHTASVNQIPFQLTSYRVLEKEK
Predicted secondary structure


























SS confidence













































Known secondary structure (DSSP)





SS
SS



S

GGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D