Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6f5dL_

Fold library idPDB HeaderMoleculeTitle
c6f5dL_3.20PDB header: hydrolaseChain: L: PDB Molecule: ribonucleoprotein p18, mitochondrial;


Added to library: Sat Feb 24 08:25:02 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AKKYDLFGYEVDTNTAPWIEKIKKCKYYDEAGEVLVNMNVSNCPPDIATYNATLQCIYQSPSKQSTPVDN
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)


B
SS

B




S
SSTTT



S
SSSSS

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence ESKFCAMMDLLEEMQHRNRLKPNEESWTWVMKECVKSGQFRLGYCIQQVMETECKGCPADLVKANEANAQ
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)

TTS






TTS



S
 .........150.........160.....
Sequence KAKTEGKEHPGHLSQQAGLFDVKVE
Predicted secondary structure








SS confidence
























Known secondary structure (DSSP) S
SS
SS

TT





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D