Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6epcN_

Fold library idPDB HeaderMoleculeTitle
c6epcN_12.30PDB header: hydrolaseChain: N: PDB Molecule: 26s proteasome non-atpase regulatory subunit 1;


Added to library: Sat Feb 10 08:35:04 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MITSAAGIISLLDEEEPQLKEFALHKLNAVVNDFWAEISESVDKIEVLYEDEGFRSRQFAALVASKVFYH
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)

S
SSS
TTT

T
SSSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LGAFEESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQR
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) T
SSS
SSS
SSS


TTT

 .........150.........160.........170.........180.........190.........200.........210
Sequence CLDDHKYKQAIGIALETRRLDVFEKTILESNDVPGMLAYSLKLCMSLMQNKQFRNKVLRVLVKIYMNLEK
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) T
T
TTTT




SS


SSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence PDFINVCQCLIFLDDTQAVSDILEKLVKEDNLLMAYQICFDLYESASQQFLSSVIQNLRTVGTPLKMIKI
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)

T
TT
S
TT



TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence LSGEMAIELHLQFLIRNNNTDLMILKNTKDAVRNSVCHTATVIANSFMHCGTTSDQFLRDNLEWLARATN
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) T



SS

STTTS





 .........360.........370.........380.........390.........400.........410.........420
Sequence WAKFTATASLGVIHKGHEKEALQLMATYLPKDTSPGSAYQEGGGLYALGLIHANHGGDIIDYLLNQLKNA
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTTT
SSSSTTSS



STTS

S
 .........430.........440.........450.........460.........470.........480.........490
Sequence SNDIVRHGGSLGLGLAAMGTARQDVYDLLKTNLYQDDAVTGEAAGLALGLVMLGSKNTQAIEDMVGYAQE
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
STTT

STT
TT
SS

 .........500.........510.........520.........530.........540.........550.........560
Sequence TQHEKILRGLAVGIALVMYGRMEEADALIESLCRDKDPILRRSGMYTVAMAYCGSGNNKAIRRLLHVAVS
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)


S
S
TTTSSSTT


 .........570.........580.........590.........600.........610.........620.........630
Sequence DVNDDVRRAAVESLGFILFRTPEQCPSVVSLLSESYNPHVRYGAAMALGVCCAGTGNKEAINLLEPMTND
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)


GGGSGGGTSS
TSSS


 .........640.........650.........660.........670.........680.........690.........700
Sequence PVNYVRQGALIASALIMIQQTEITCPKVNQFRQLYSKVINDKHDDVMAKFGAILAQGILDAGGHNVTISL
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) SS
SS
TTT

SSS
TT

S
 .........710.........720.........730.........740.........750.........760.........770
Sequence QSRTGHTHMPSVVGVLVFTQFWFWFPLSHFLSLAYTPTCIIGLNKDLKMPKVQYKSNCKPSTFAYPAPLE
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) S
SSSS

T

SS
SGGGGG

S




TTSS





SSS







 .........780.........790.........800.........810.........820.........830.........840
Sequence VPKEKEKEKVSTAVLSITAKAKKKEKEKEKKEEEKMEVDEAEKKEEKEKKKEPEPNFQLLDNPARVMPAQ
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
SS
SSSSSS


STT
















S
SSSSS



SS
 .........850.........860.........870.........880.........890.........900.....
Sequence LKVLSMTETCRYQPFKPLSIGGIIILKDTSEDIEELVEPVAAHGPKIEEEEQEPEPPEPFEYIDD
Predicted secondary structure







































SS confidence
































































Known secondary structure (DSSP) TT

SS


S

SSTTBSS

TTSS


SSSS


SS




SSS


S





S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D