Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6epcN_

Fold library idPDB HeaderMoleculeTitle
c6epcN_12.30PDB header: hydrolaseChain: N: PDB Molecule: 26s proteasome non-atpase regulatory subunit 1;


Added to library: Sat Feb 10 08:35:04 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MITSAAGIISLLDEEEPQLKEFALHKLNAVVNDFWAEISESVDKIEVLYEDEGFRSRQFAALVASKVFYH
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)

S
SSS
TTT

T
SSSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LGAFEESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQR
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) T
SSS
SSS
SSS


TTT

 .........150.........160.........170.........180.........190.........200.........210
Sequence CLDDHKYKQAIGIALETRRLDVFEKTILESNDVPGMLAYSLKLCMSLMQNKQFRNKVLRVLVKIYMNLEK
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) T
T
TTTT




SS


SSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence PDFINVCQCLIFLDDTQAVSDILEKLVKEDNLLMAYQICFDLYESASQQFLSSVIQNLRTVGTPLKMIKI
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)

T
TT
S
TT



TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence LSGEMAIELHLQFLIRNNNTDLMILKNTKDAVRNSVCHTATVIANSFMHCGTTSDQFLRDNLEWLARATN
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) T



SS

STTTS





 .........360.........370.........380.........390.........400.........410.........420
Sequence WAKFTATASLGVIHKGHEKEALQLMATYLPKDTSPGSAYQEGGGLYALGLIHANHGGDIIDYLLNQLKNA
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTTT
SSSSTTSS



STTS

S
 .........430.........440.........450.........460.........470.........480.........490
Sequence SNDIVRHGGSLGLGLAAMGTARQDVYDLLKTNLYQDDAVTGEAAGLALGLVMLGSKNTQAIEDMVGYAQE
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
STTT

STT
TT
SS

 .........500.........510.........520.........530.........540.........550.........560
Sequence TQHEKILRGLAVGIALVMYGRMEEADALIESLCRDKDPILRRSGMYTVAMAYCGSGNNKAIRRLLHVAVS
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)


S
S
TTTSSSTT


 .........570.........580.........590.........600.........610.........620.........630
Sequence DVNDDVRRAAVESLGFILFRTPEQCPSVVSLLSESYNPHVRYGAAMALGVCCAGTGNKEAINLLEPMTND
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)


GGGSGGGTSS
TSSS


 .........640.........650.........660.........670.........680.........690.........700
Sequence PVNYVRQGALIASALIMIQQTEITCPKVNQFRQLYSKVINDKHDDVMAKFGAILAQGILDAGGHNVTISL
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) SS
SS
TTT

SSS
TT

S
 .........710.........720.........730.........740.........750.........760.........770
Sequence QSRTGHTHMPSVVGVLVFTQFWFWFPLSHFLSLAYTPTCIIGLNKDLKMPKVQYKSNCKPSTFAYPAPLE
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) S
SSSS

T

SS
SGGGGG

S




TTSS





SSS







 .........780.........790.........800.........810.........820.........830.........840
Sequence VPKEKEKEKVSTAVLSITAKAKKKEKEKEKKEEEKMEVDEAEKKEEKEKKKEPEPNFQLLDNPARVMPAQ
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
SS
SSSSSS


STT
















S
SSSSS



SS
 .........850.........860.........870.........880.........890.........900.....
Sequence LKVLSMTETCRYQPFKPLSIGGIIILKDTSEDIEELVEPVAAHGPKIEEEEQEPEPPEPFEYIDD
Predicted secondary structure







































SS confidence
































































Known secondary structure (DSSP) TT

SS


S

SSTTBSS

TTSS


SSSS


SS




SSS


S





S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D