Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6eowC_

Fold library idPDB HeaderMoleculeTitle
c6eowC_1.80PDB header: transferaseChain: C: PDB Molecule: ketone/zingerone synthase 1;


Added to library: Sat Oct 27 09:09:28 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QVSNKQVIFRDYVTGFPKESDMELTTRSITLKLLLKNLYLSCDPYMRARMTNLSYVDSFKPGSPIIGYGV
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

S


SS

GGG





GGGGGGG



SS



TTSB
 .........80.........90.........100.........110.........120.........130.........140
Sequence ARVLESGNPKFNPGDLVWGFTGWEEYSVITLFKIHNTDVPLSYYTGLLGMPGMTAYAGFYEICSPKKGET
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
SSTT

TT
SBS






SS
GGGGGTTTSS


TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence VYVSAASGAVGQLVGQFAKLTGCYVVGSAGSKEKVDLLKNKFGFDEAFNYKEEADLDAALRRYFPDGIDI
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) SSTTSTTT
SSTS

SGGG
S

TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence YFENVGGKMLDAVLPNMRPKGRIAVCGMISQYNLEQPEGVRNLMALIVKQVRMEGFMVFSYYHLYGKFLE
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) SS
GGG


GGGTT
SS





TTTT


GGGGGGG
 .........290.........300.........310.........320.......
Sequence TVLPYIKQGKITYVEDVVDGLDNAPAALIGLYSGRNVGKQVVVVSRE
Predicted secondary structure

















SS confidence














































Known secondary structure (DSSP) TTSS



GGGGGGGT

SSSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D