Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6eotG_

Fold library idPDB HeaderMoleculeTitle
c6eotG_3.50PDB header: hydrolaseChain: G: PDB Molecule: dipeptidyl peptidase 8;


Added to library: Sat Feb 10 08:44:10 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LEPFYVERYSWSQLKKLLADTRKYHKAPHDFMFVKRNDPDGPHSDRIYYLAMRENTLFYSEIPKTINRAA
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)







TS







SSSS


BS


SSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence VLMLSWKPLLDLFQATYSREEELLRERKRIGTVGIASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQP
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

B


SB

TT



TT



B




TTT
BTT
B
SSTT


SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence LRPNLVETSCPNIRMDPKLCPADPDWIAFIHSNDIWISNIVTREERRLTYVHNELANMEEDARSAGVATF
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) B






SS


SS
TTTTTTT





S
SSS
TTT

S


 .........220.........230.........240.........250.........260.........270.........280
Sequence VLQEEFDRYSGYWWCPKAETTPSGGKILRILYEENDESEVEIIHVTSPMLETRRADSFRYPKTGTANPKV
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) S





SS

TTS

TTS

S
TTT



BTTS




 .........290.........300.........310.........320.........330.........340.........350
Sequence TFKMSEIMIDAEGRIIDVIDKELIQPFEILFEGVEYIARAGWTPEGKYAWSILLDRSQTRLQIVLISPEL
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)

TTS
SS
TTT
TTSS
TTS

GGG
 .........360.........370.........380.........390.........400.........410.........420
Sequence FIPVEDDVMERQRLIESVPDSVTPLIIYEETTDIWINIHDIFHVFPQSHEEEIEFIFASECKTGFRHLYK
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)

S
S
SS



SS




S




STTSTTTSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence ITSILKESKYKRSSGGLPAPSDFKCPIKEEIAITSGEWEVLGRHGSNIQVDEVRRLVYFEGTKDSPLEHH
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)



S

GGG
S


SGGGB




SSS
B

STT


TTTTTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence LYVVSYVNPGEVTRLTDRGYSHSCCISQHCDFFISKYSNQKNPHCVSLYKLSSPEDDPTCKTKEFWATIL
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) SSS




S
SSS
TTSS
SSS



TT
TT

 .........570.........580.........590.........600.........610.........620.........630
Sequence DSAGPLPDYTPPEIFSFESTTGFTLYGMLYKPHDLQPGKKYPTVLFIYGGPQVQLVNNRFKGVKYFRLNT
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)



S
TT




TTSS

SS

TT



TT



SSS
TTSTT
 .........640.........650.........660.........670.........680.........690.........700
Sequence LASLGYVVVVIDNRGSCHRGLKFEGAFKYKMGQIEIDDQVEGLQYLASRYDFIDLDRVGIHGWSYGGYLS
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) T


TT
SSS
TTTT
TTT
TTT
 .........710.........720.........730.........740.........750.........760.........770
Sequence LMALMQRSDIFRVAIAGAPVTLWIFYDTGYTERYMGHPDQNEQGYYLGSVAMQAEKFPSEPNRLLLLHGF
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
TTT
SS

S
GGGSBT

GGG

GGGGGGGS
SSSSST
 .........780.........790.........800.........810.........820.........830......
Sequence LDENVHFAHTSILLSFLVRAGKPYDLQIYPQERHSIRVPESGEHYELHLLHYLQENLGSRIAALKV
Predicted secondary structure




























SS confidence

































































Known secondary structure (DSSP) T
TTTTTT


TT
SSS

STTST


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D