Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6eotG_

Fold library idPDB HeaderMoleculeTitle
c6eotG_3.50PDB header: hydrolaseChain: G: PDB Molecule: dipeptidyl peptidase 8;


Added to library: Sat Feb 10 08:44:10 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LEPFYVERYSWSQLKKLLADTRKYHKAPHDFMFVKRNDPDGPHSDRIYYLAMRENTLFYSEIPKTINRAA
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)







TS







SSSS


BS


SSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence VLMLSWKPLLDLFQATYSREEELLRERKRIGTVGIASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQP
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

B


SB

TT



TT



B




TTT
BTT
B
SSTT


SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence LRPNLVETSCPNIRMDPKLCPADPDWIAFIHSNDIWISNIVTREERRLTYVHNELANMEEDARSAGVATF
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) B






SS


SS
TTTTTTT





S
SSS
TTT

S


 .........220.........230.........240.........250.........260.........270.........280
Sequence VLQEEFDRYSGYWWCPKAETTPSGGKILRILYEENDESEVEIIHVTSPMLETRRADSFRYPKTGTANPKV
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) S





SS

TTS

TTS

S
TTT



BTTS




 .........290.........300.........310.........320.........330.........340.........350
Sequence TFKMSEIMIDAEGRIIDVIDKELIQPFEILFEGVEYIARAGWTPEGKYAWSILLDRSQTRLQIVLISPEL
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)

TTS
SS
TTT
TTSS
TTS

GGG
 .........360.........370.........380.........390.........400.........410.........420
Sequence FIPVEDDVMERQRLIESVPDSVTPLIIYEETTDIWINIHDIFHVFPQSHEEEIEFIFASECKTGFRHLYK
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)

S
S
SS



SS




S




STTSTTTSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence ITSILKESKYKRSSGGLPAPSDFKCPIKEEIAITSGEWEVLGRHGSNIQVDEVRRLVYFEGTKDSPLEHH
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)



S

GGG
S


SGGGB




SSS
B

STT


TTTTTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence LYVVSYVNPGEVTRLTDRGYSHSCCISQHCDFFISKYSNQKNPHCVSLYKLSSPEDDPTCKTKEFWATIL
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) SSS




S
SSS
TTSS
SSS



TT
TT

 .........570.........580.........590.........600.........610.........620.........630
Sequence DSAGPLPDYTPPEIFSFESTTGFTLYGMLYKPHDLQPGKKYPTVLFIYGGPQVQLVNNRFKGVKYFRLNT
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)



S
TT




TTSS

SS

TT



TT



SSS
TTSTT
 .........640.........650.........660.........670.........680.........690.........700
Sequence LASLGYVVVVIDNRGSCHRGLKFEGAFKYKMGQIEIDDQVEGLQYLASRYDFIDLDRVGIHGWSYGGYLS
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) T


TT
SSS
TTTT
TTT
TTT
 .........710.........720.........730.........740.........750.........760.........770
Sequence LMALMQRSDIFRVAIAGAPVTLWIFYDTGYTERYMGHPDQNEQGYYLGSVAMQAEKFPSEPNRLLLLHGF
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
TTT
SS

S
GGGSBT

GGG

GGGGGGGS
SSSSST
 .........780.........790.........800.........810.........820.........830......
Sequence LDENVHFAHTSILLSFLVRAGKPYDLQIYPQERHSIRVPESGEHYELHLLHYLQENLGSRIAALKV
Predicted secondary structure




























SS confidence

































































Known secondary structure (DSSP) T
TTTTTT


TT
SSS

STTST


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D