Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6db1A_

Fold library idPDB HeaderMoleculeTitle
c6db1A_2.00PDB header: transferaseChain: A: PDB Molecule: putative methyl-accepting chemotaxis protein;


Added to library: Sat May 19 08:39:01 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DIDRHLVRQXTVLSQGNDQYFRFVTRLSRAXDVKIGGGTPDFAPARQSLENXRQKLEEXKALSPGPXNPD
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)
TTS




STTS
 .........80.........90.........100.........110.........120.........130.......
Sequence ISREVLSNWQALLEKGVVPQXQLAQQGSLTAWSEHASTVTPALSRAFGASAERFSHEAGAXLDNTRV
Predicted secondary structure










SS confidence


































































Known secondary structure (DSSP) TTT

TTTT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D