Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6cbpA_

Fold library idPDB HeaderMoleculeTitle
c6cbpA_2.17PDB header: immune systemChain: A: PDB Molecule: dh270.6 single chain variable fragment;


Added to library: Sat Feb 24 08:49:22 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QVQLVQSGAQMKNPGASVKVSCAPSGYTFTDFYIHWLRQAPGQGLQWMGWMNPQTGRTNTARNFQGRVTM
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)





TT

SS
GGG
TTS

TTT


GGGTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence TRDTSIGTAYMELRSLTSDDTAIYYCTTGGWISLYYDSSYYPNFDHWGQGTLLTVSGALTQPASVSGSPG
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TTTT
S

GGG


SSS

TT





B





BB

S
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence QSITISCTGTKYDVGSHDLVSWYQQYPGKVPKYMIYEVNKRPSGVSNRFSGSKSGNTASLTISGLRAEDE
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)



TTTTTSSS

TTS

BTTTB

TT

TTTT
S

GGG
 .........220.........230.....
Sequence ADYYCCSFGGSATVVCGGGTKVTVH
Predicted secondary structure




SS confidence
























Known secondary structure (DSSP) STTB



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D