Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6c2pB_

Fold library idPDB HeaderMoleculeTitle
c6c2pB_2.70PDB header: transcription/dna/rnaChain: B: PDB Molecule: rnap2;


Added to library: Sat Feb 3 08:21:06 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MQTFTAREYLKIDIANNYGLDKEDWDDRIAWFDKNENNLLNLVREAEEPALFYAGVKAWMDVKEGKPIGY
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)




TTTTTTS
GGGGGGSGGGSSSTT




 .........80.........90.........100.........110.........120.........130.........140
Sequence PVALDATSSGLQILACLTGDRRAAELCNVVNYRDESGKVKRRDAYTVIYNKMLNTLGKGARIKRNDCKQA
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
BSST
TSS

B
TT

B




TT



 .........150.........160.........170.........180.........190.........200.........210
Sequence IMTALYGSEAKPKEVFGEGIMLNVFESTMNVEAPAVWELNKFWLQCGNPEAFVYHWVMPDGFNVYIKVMV
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TT
STTS
TT

TT
S
TTS

 .........220.........230.........240.........250.........260.........270.........280
Sequence NEVETVHFLDKPYDCVRKVQGTEEKTRMLSANTTHSIDGLVVRELVRRCDYDKNQIEYIKALCNGEAEYK
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) SSS



SS
S
S

TT
S


 .........290.........300.........310.........320.........330.........340.........350
Sequence ASEKNYGKAMELWGYYEKTGFLTARIFDYLDSETIKLVNTQDILDLIESMPKKPFHVLTVHDCFRCLPNY
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

S


GGGGGG

TTGGGGS
TS
SS



SSS
GGG
 .........360.........370.........380.........390.........400....
Sequence GNDIRRQYNNLLATIAKGDLLSFIMSQVIGQEVTIGKLDPTLWEDVLETEYALS
Predicted secondary structure





















SS confidence





















































Known secondary structure (DSSP) S
TS





SSTTTT
S
SB


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D