Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6c2lA_

Fold library idPDB HeaderMoleculeTitle
c6c2lA_3.20PDB header: transcription/dna/rnaChain: A: PDB Molecule: rnap1;


Added to library: Sat Feb 3 08:16:07 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence STIEHQMHLEKLYNKNQLLPRMRQEFEENSGIDFKAFFAHIGIDYKFGIDAMVQMALHKRADLPTLVGTL
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
T
TTT
SS
TT

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence RHHCKSAQEVADNLFKMASEDCFNFDPTIDKFIVIYTISDDVQHELDSFQYPLPMVVRPKLLTKNYGTGY
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) GGGSSSTTSSTTTT
SS


SS


BSS





SSB

SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence FTCNKSVILKKNHTDDDICLDHLNRMNKIPLSINWDVAHMVKNEWANAFQKYDRTAHEVMGLLTQEGNKF
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) SS

SBSSSSS


SS


T


T



GGG
S
B
 .........220.........230.........240.........250
Sequence YLTHRPDKRGRTYSQGYHVNYQGTSWNKAVLEFAEKEVID
Predicted secondary structure

















SS confidence







































Known secondary structure (DSSP) B


TTS


SSS
SSS
TTSS





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D