Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6c2lA_

Fold library idPDB HeaderMoleculeTitle
c6c2lA_3.20PDB header: transcription/dna/rnaChain: A: PDB Molecule: rnap1;


Added to library: Sat Feb 3 08:16:07 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence STIEHQMHLEKLYNKNQLLPRMRQEFEENSGIDFKAFFAHIGIDYKFGIDAMVQMALHKRADLPTLVGTL
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
T
TTT
SS
TT

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence RHHCKSAQEVADNLFKMASEDCFNFDPTIDKFIVIYTISDDVQHELDSFQYPLPMVVRPKLLTKNYGTGY
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) GGGSSSTTSSTTTT
SS


SS


BSS





SSB

SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence FTCNKSVILKKNHTDDDICLDHLNRMNKIPLSINWDVAHMVKNEWANAFQKYDRTAHEVMGLLTQEGNKF
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) SS

SBSSSSS


SS


T


T



GGG
S
B
 .........220.........230.........240.........250
Sequence YLTHRPDKRGRTYSQGYHVNYQGTSWNKAVLEFAEKEVID
Predicted secondary structure

















SS confidence







































Known secondary structure (DSSP) B


TTS


SSS
SSS
TTSS





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D