Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bypA_

Fold library idPDB HeaderMoleculeTitle
c6bypA_1.90PDB header: lyaseChain: A: PDB Molecule: short ulvan lyase;


Added to library: Sat Feb 10 08:27:38 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SGVLLESQTKITDGALHFDGKKLNHNTFENPSKSQAYDYFFGRNISAHGDAVKPYKHFVFMTWYKGGKEE
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)





S
B

TTTTTS


SSS

BSS
S

SS
SS
TTBSSTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence RNVMLSRFNTKTGVVKTIQFPHRHTGFRGDPLVGESHNTIGLAVSPLNGTIHMVYDMHAYVDDDETGRFK
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)
TTT




BTTBTTSB
TT


TTT

S
BS




TTSTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence GRFVDDFFRYSFSVAGAADVPDDEFTLEQFVKDTSELSQGADDYKHLTMTGNLQDKENFSALTYPKFYTS
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP) TTTTT
SS
B
TTGGGS
GGG
SGGGB



STT


TT


BS
SSS
GGGGGGG
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence DDGELLHYMRWGGNNNGAYYFNKYDAKNQKWTRFTPFNHKDQKTHGNAYNWGLYGQMKYINGKLRVGFQQ
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TTS
TTTTTT


SB
SSGGGTT
SS
TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence RSANNDDRFKYQNGVYYAYSDHPDGLGNWKNVDGEDMTWPLVNSDEIKIFEPGDYIDHTAPNSVHIVTGF
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) S

SSSBSS
SSTTSSS

TTS
B

SSB

GGGG
GGGGS


STT


S

 .........360.........370.........380.........390.........400.........410.........420
Sequence DWTVTENDDVHFITHVRSTDTKRSDYKEVSIHAFKPANAVDFTITTDFTGADSIYTSGDSIFIIGLKNGY
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
TT

S
TT
TT


TT
SS
S




S

TTTT
 .........430.........440.........450.........460.........470.........480.
Sequence PFVEKAKGGSNDFEVVYQQASGVKFDHGTIHIENGKAYYYLMEKGAGNALPLHLQVIDLGV
Predicted secondary structure

























SS confidence




























































Known secondary structure (DSSP) TT





SS

TT

SSS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D