Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bypA_

Fold library idPDB HeaderMoleculeTitle
c6bypA_1.90PDB header: lyaseChain: A: PDB Molecule: short ulvan lyase;


Added to library: Sat Feb 10 08:27:38 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SGVLLESQTKITDGALHFDGKKLNHNTFENPSKSQAYDYFFGRNISAHGDAVKPYKHFVFMTWYKGGKEE
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)





S
B

TTTTTS


SSS

BSS
S

SS
SS
TTBSSTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence RNVMLSRFNTKTGVVKTIQFPHRHTGFRGDPLVGESHNTIGLAVSPLNGTIHMVYDMHAYVDDDETGRFK
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)
TTT




BTTBTTSB
TT


TTT

S
BS




TTSTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence GRFVDDFFRYSFSVAGAADVPDDEFTLEQFVKDTSELSQGADDYKHLTMTGNLQDKENFSALTYPKFYTS
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP) TTTTT
SS
B
TTGGGS
GGG
SGGGB



STT


TT


BS
SSS
GGGGGGG
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence DDGELLHYMRWGGNNNGAYYFNKYDAKNQKWTRFTPFNHKDQKTHGNAYNWGLYGQMKYINGKLRVGFQQ
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TTS
TTTTTT


SB
SSGGGTT
SS
TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence RSANNDDRFKYQNGVYYAYSDHPDGLGNWKNVDGEDMTWPLVNSDEIKIFEPGDYIDHTAPNSVHIVTGF
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) S

SSSBSS
SSTTSSS

TTS
B

SSB

GGGG
GGGGS


STT


S

 .........360.........370.........380.........390.........400.........410.........420
Sequence DWTVTENDDVHFITHVRSTDTKRSDYKEVSIHAFKPANAVDFTITTDFTGADSIYTSGDSIFIIGLKNGY
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
TT

S
TT
TT


TT
SS
S




S

TTTT
 .........430.........440.........450.........460.........470.........480.
Sequence PFVEKAKGGSNDFEVVYQQASGVKFDHGTIHIENGKAYYYLMEKGAGNALPLHLQVIDLGV
Predicted secondary structure

























SS confidence




























































Known secondary structure (DSSP) TT





SS

TT

SSS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D