Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6brmC_

Fold library idPDB HeaderMoleculeTitle
c6brmC_2.55PDB header: hydrolaseChain: C: PDB Molecule: putative metal-dependent isothiocyanate hydrolase saxa;


Added to library: Sat Feb 3 08:21:08 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MKLTQIRNATLVLQYAGKKFLIDPMLAEKEAWDGFAGSARPHLRNPMVALPVPVEDLLAVDAVILTHTHT
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)
TTTTS




TT
B


SSBS

SS
B
SS

SS
T
SSS


G
 .........80.........90.........100.........110.........120.........130.........140
Sequence DHWDEAAQQAVPKDMLIYTQDEKDAALIRSQGFFNIRVLKDENHFVDGLTIYKTDGQHGSNELYADAQLG
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) GGS
S
SSS
SSTT




S
TTS



SS
TTGGGS
 .........150.........160.........170.........180.........190.........200.........210
Sequence DLLGDACGLVFTHHDEKTIYIAGDTVWVKPYVKSLQRFKPEIVVLNTGYAVNDLYGPIIMGKEDTLRTLK
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)




SSS



S

S


S


BTTTSS

 .........220.........230.........240.........250.........260..
Sequence MLPTATIVASHMESINHCLLTRAELREFSLEHGIEDKILIPADGETMAFSAW
Predicted secondary structure
























SS confidence



















































Known secondary structure (DSSP)
TT
S
SSSTTB


TT
TTT


TT





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D