Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6brmC_

Fold library idPDB HeaderMoleculeTitle
c6brmC_2.55PDB header: hydrolaseChain: C: PDB Molecule: putative metal-dependent isothiocyanate hydrolase saxa;


Added to library: Sat Feb 3 08:21:08 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MKLTQIRNATLVLQYAGKKFLIDPMLAEKEAWDGFAGSARPHLRNPMVALPVPVEDLLAVDAVILTHTHT
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)
TTTTS




TT
B


SSBS

SS
B
SS

SS
T
SSS


G
 .........80.........90.........100.........110.........120.........130.........140
Sequence DHWDEAAQQAVPKDMLIYTQDEKDAALIRSQGFFNIRVLKDENHFVDGLTIYKTDGQHGSNELYADAQLG
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) GGS
S
SSS
SSTT




S
TTS



SS
TTGGGS
 .........150.........160.........170.........180.........190.........200.........210
Sequence DLLGDACGLVFTHHDEKTIYIAGDTVWVKPYVKSLQRFKPEIVVLNTGYAVNDLYGPIIMGKEDTLRTLK
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)




SSS



S

S


S


BTTTSS

 .........220.........230.........240.........250.........260..
Sequence MLPTATIVASHMESINHCLLTRAELREFSLEHGIEDKILIPADGETMAFSAW
Predicted secondary structure
























SS confidence



















































Known secondary structure (DSSP)
TT
S
SSSTTB


TT
TTT


TT





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D