Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bl5A_

Fold library idPDB HeaderMoleculeTitle
c6bl5A_1.69PDB header: viral proteinChain: A: PDB Molecule: head decoration protein;


Added to library: Sat Feb 24 08:29:10 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RVPRLHAYGVFALPFPMDPDVEWGNWFAGPHPKAFLVSVHPSGPKAGHVYPTDLSDPDSVANVIGMVLDG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)




GGG

B
TTS
GGGG

SSS

B

SSTTTT


TT
T
S
 .........80.........90.........100.........110.........120.........
Sequence HDYEADHNVTVTLRAAVPIEYVQQGIEAPPLQPDPAVLNAAPQLKLKVIKGHYFFDYTR
Predicted secondary structure



























SS confidence


























































Known secondary structure (DSSP)

TTT
SGGGB

SSSS
TTS

T
TTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D