Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bk8D_

Fold library idPDB HeaderMoleculeTitle
c6bk8D_3.30PDB header: rna binding proteinChain: D: PDB Molecule: pre-mrna-splicing factor prp46;


Added to library: Sat Feb 24 08:53:38 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HASAFVNKIFQPEVAEELIVNRYEKLLSQRPEWHAPWKLSRVINGHLGWVRCVAIDPVDNEWFITGSNDT
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)


SSTTTSTT










SS



SSS


SSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence TMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSI
Predicted secondary structure























































SS confidence





































































Known secondary structure (DSSP) TTT



SS

SSSSTTS
TTTT


SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence HPTLDLIATAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGKTMK
Predicted secondary structure

































































SS confidence





































































Known secondary structure (DSSP)
SSS
TTSSSSS




SS

SSSS
TTS

TTTSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence VLTHHKRSVRATALHPKEFSVASACTDDIRSWGLAEGSLLTNFESEKTGIINTLSINQDDVLFAGGDNGV
Predicted secondary structure




































































SS confidence





































































Known secondary structure (DSSP)


SS



TTTS
SS

TTT


B


TT


B



TTSBTTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence LSFYDYKSGHKYQSLATREMVGSLEGERSVLCSTFDKTGLRLITGEADKSIKIWKQDETATKESEPGLAW
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) SSS





SS

STT


SSSSTTT

TT

TTTS

S

 .........
Sequence NPNLSAKRF
Predicted secondary structure





SS confidence








Known secondary structure (DSSP)


STTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D