Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bhcA_

Fold library idPDB HeaderMoleculeTitle
c6bhcA_2.30PDB header: transferaseChain: A: PDB Molecule: pseudopodium-enriched atypical kinase 1;


Added to library: Sat Dec 16 09:09:00 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EVVGKIRSLHTDALKKLAVKCEDLFMAGQKDQLRFGVDSWSDFRLTSDKPCCEAGDAVYYTASYAKDPLN
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
T
S







TTGGGGS
SS
S
SSTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence NYAVKICKSHSLAVRQSLAVHFNIQQDCGHFLAEVPNRLLPWEDKQRSHVVVITREVPCLTVADFVRDSL
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)


TS


TTB


S

GGG
TT



SS


TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence AQHGKSPDLYERQVCLLLLQLCSGLEHLKPYHVTHCDLRLENLLLVHYQPTRLIVSNFSQAKQKRDQSRL
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
GGGT




GGG







TT



GGGS
 .........220.........230.........240.........250.........260.........270.........280
Sequence APEIITAKKCDEFQTGILIYEMLHLPNPFDENPELKEREYTRADLPRIPFRSPYSRGLQQLASCLLNPNP
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)



TT


STTSTTTT

TTTS





STTT
SST
 .........290.........300.........310.........320.........330.........340.........350
Sequence SERILISDAKGILQCLLWGPREDLFQTFTACPSLVQRNTLLQNWLDIKRTLLMIKFAEKSLDGISLEDWL
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TTS

TS



STT



 .........360.........370.
Sequence CAQYLAFATTDSLSCIVKILL
Predicted secondary structure


SS confidence




















Known secondary structure (DSSP)



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D