Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6b07B_

Fold library idPDB HeaderMoleculeTitle
c6b07B_1.98PDB header: transferase/transferase inhibitorChain: B: PDB Molecule: farnesyl diphosphate synthase;


Added to library: Sat Dec 16 08:30:49 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KKESFEDVLPSILNTITTNSELTEVPEVANWLKKVLEYNLAGGKKARGLTTLFAYEMLEKPENITEETIY
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
TTTSGGGG
SSS

S
GGG

 .........80.........90.........100.........110.........120.........130.........140
Sequence LAKTLGWCVEILQGFLVMLDDIMDGSTTRRGVPCWYQLPEVGLAAVNDSSLMFSSIFYVLHAHFADKKIY
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) T

TT
GGGSTTTGGGTTSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence TNLVELFNESLMHTSIGQHLDVTMRQKSDYSLFTIERYNAIVKYKTAYYTYQLPVCLGMLLANISDPVLH
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)



SS

TT
STTTT


 .........220.........230.........240.........250.........260.........270.........280
Sequence QKAEDMCLEIGKFFQIQDDYIDCYGDESLTGKMGTDIQEAKCSWLAVMALQRCSASQKIVFTTCYGSKEP
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)


S


TTTTT




TT


 .........290.........300.........310.........320.........330........
Sequence AHIERIKELYKQLQLPELYAQEETRMYESLIKQAHGLPSELSPALFVRLIHMIYKRNH
Predicted secondary structure









SS confidence

























































Known secondary structure (DSSP) TTTS
GGG
TT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D