Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6aztA_

Fold library idPDB HeaderMoleculeTitle
c6aztA_1.80PDB header: plant proteinChain: A: PDB Molecule: asparaginyl endopeptidase 1;


Added to library: Sat Feb 10 08:27:53 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GTKWAVLVAGSKGYGNYRHQADVCHAYQVLKKGGLKDENIVVFMYDDIAKSEMNPRPGIIINSPKGEDVY
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)





SGGGTT

GGG



STT
TT
SSTT


SSTT


SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence AGVPKDYTGKNVTVDNLSAVLLGDRSAVKGGSGKVVDSKPEDRIFLFYSHGGPGVLGMPNEPHLVAKDLV
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) TT


SB
GGG

T
GGG

SS







TT


TT

SSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence DVLKKKHAMGTYKEMVIYLEACESGSIFEGILPEDLNIYATTASGAQENSYGTYCPGTEPSPPPEYITCL
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) T

S
STTGGGGTTTTS
TTSSSS
TT



S
TTSSS


TT

S
S
 .........220.........230.........240.........250.........260.........270...
Sequence GDLYSVAWMEDSETHNLKKESLEQQFNKVKKRTSNGSHVMEYGSKDIKPEKVYLYLGFDPATV
Predicted secondary structure






























SS confidence






























































Known secondary structure (DSSP) TTS
TTT
B





GGGTTSBT


GGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D