Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6ax6B_

Fold library idPDB HeaderMoleculeTitle
c6ax6B_2.24PDB header: oxidoreductaseChain: B: PDB Molecule: procollagen lysyl hydroxylase and glycosyltransferase;


Added to library: Sat Feb 24 08:28:49 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EVTLYDLPTRKEEWEKKYLHPEFLSHLQNFKDFDYTEICNDVYSFPLFTPAFCKEVIEVMDKANLWSKPT
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)


TT
TTTTB
TTT
GGG


TT
B
T





 .........80.........90.........100.........110.........120.........130.........140
Sequence QDTQLYEVGLDKQWHYVVFNYVAPFVRHLYNNYKTKDINLAFVVKYDMERQSELAPHHDSSTYTLNIALN
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
GGGGT
TTTT




SS






B

SSS
S
 .........150.........160.........170.........180.........190.......
Sequence EYGKEYTAGGCEFIRHKFIWQGQKVGYATIHAGKLLAYHRALPITSGKRYILVSFVN
Predicted secondary structure






























SS confidence
























































Known secondary structure (DSSP)
BTTT

TTTT



TTSSSS





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D