Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ywzA_

Fold library idPDB HeaderMoleculeTitle
c5ywzA_2.20PDB header: nuclear proteinChain: A: PDB Molecule: sun domain-containing protein 1;


Added to library: Sat Feb 24 08:29:33 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SKDELQVLLHDLELKLLQNITHHITVTGQAPTSEAIVSAVNQAGISGITEAQAHIIVNNALKLYSQDKTG
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)
SS


TT




S
S



 .........80.........90.........100.........110.........120.........130.........140
Sequence MVDFALESGGGSILSTRCSETYETKTALLSLFGVPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRL
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)


TT
GGGT

GGGS

B



TTSS
B
GGGGGSSS

TT

TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence SMKIYPTTFTMEHIPKTLSPTGNISSAPKDFAVYGLETEYQEEGQPLGRFTYDQEGDSLQMFHTLERPDQ
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)


GGGSTTS

TTSB
SSTT
SS


TTS
S
SS

SS
 .........220.........230.........240..
Sequence AFQIVELRVLSNWGHPEYTCLYRFRVHGEPIQ
Predicted secondary structure












SS confidence































Known secondary structure (DSSP)


BSS
SS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D