Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ys0A_

Fold library idPDB HeaderMoleculeTitle
c5ys0A_2.60PDB header: transport proteinChain: A: PDB Molecule: membrane-anchored lipid-binding protein ysp2;


Added to library: Sat Feb 3 08:18:53 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TVIDEKINIPVPLGTVFSLLYGDDTSYIKKIIENQNNFNVCDIPKFVNNAREITYTKKLNNSFGPKQTKC
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
SS
SS
TTSSS






BTT

SSSS
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence IVTETIEHMDLNSFFMVKQIVRSPDVPYGSSFSVHTRFFYSWGDHNTTNMKVVTNVVWTGKSMLKGTIEK
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TTT
TTSTTTTS
TTS
SS

TT
 .........150.........160
Sequence GSIDGQRSSTKQLVDDLKKI
Predicted secondary structure


SS confidence



















Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D