Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yfpG_

Fold library idPDB HeaderMoleculeTitle
c5yfpG_4.40PDB header: exocytosisChain: G: PDB Molecule: exocyst complex component exo70;


Added to library: Sat Feb 3 08:23:08 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MPAEIDIDEADVLVLSQELQKTSKLTFEINKSLKKIAATSNQSSQLFTPILARNNVLTTLQRNIESTLNS
Predicted secondary structure


SS confidence





































































Known secondary structure (DSSP)

S


GGGS
 .........80.........90.........100.........110.........120.........130.........140
Sequence VASVKDLANEASKYEIILQKGINQVGLKQYTQVVHKLDDMLEDIQSREENSEFHGILTHLEQLIKRSEAQ
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) S

SGGG
STTT
TTSSGGG




 .........150.........160.........170.........180.........190.........200.........210
Sequence LRVYFISILNSIKPFDPQINITKKMPFPYYEDQQLGALSWILDYFHGNSEGSIIQDILVGERSKLILKCM
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) T
S



TTS







SST
 .........220.........230.........240.........250.........260.........270.........280
Sequence AFLEPFAKEISTAKNAPYEKGSSGMNSYTEALLGFIANEKSLVDDLYSQYTESKPHVLSQILSPLISAYA
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TS



SSSSSS

S

SSS
S

TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence KLFGANLKIVRSNLENFGFFSFELVESINDVKKSLRGKELQNYNLLQDCTQEVRQVTQSLFRDAIDRIIK
Predicted secondary structure

SS confidence





































































Known secondary structure (DSSP) T
SSTTSS
STTS

SS


S
 .........360.........370.........380.........390.........400.........410.........420
Sequence KANSISTIPSNNGVTEATVDTMSRLRKFSEYKNGCLGAMDNITRENWLPSNYKEKEYTLQNWEDHNVLLS
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) T

S

SS



TTSST
S

GGGG

TT

GGGS




S
 .........430.........440.........450.........460.........470.........480.........490
Sequence CFISDCIDTLAVNLERKAQIALMPNQEPDVANPNSSKNKHKQRIGFFILMNLTLVEQIVEKSELNLMLAG
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) STTS



S
TT
SS
S
TSSSS
T
 .........500.........510.........520.........530.........540.........550.........560
Sequence EGHSRLERLKKRYISYMVSDWRDLTANLMDSVFIDSSGKKSKDKEQIKEKFRKFNEGFEDLVSKTKQYKL
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) TTTSSSSSSS
TT


 .........570.........580.........590.........600.........610.....
Sequence SDPSLKVTLKSEIISLVMPMYERFYSRYKDSFKNPRKHIKYTPDELTTVLNQLVR
Predicted secondary structure

















SS confidence






















































Known secondary structure (DSSP)



S
S
GGGT



TS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D