Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yfpG_

Fold library idPDB HeaderMoleculeTitle
c5yfpG_4.40PDB header: exocytosisChain: G: PDB Molecule: exocyst complex component exo70;


Added to library: Sat Feb 3 08:23:08 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MPAEIDIDEADVLVLSQELQKTSKLTFEINKSLKKIAATSNQSSQLFTPILARNNVLTTLQRNIESTLNS
Predicted secondary structure


SS confidence





































































Known secondary structure (DSSP)

S


GGGS
 .........80.........90.........100.........110.........120.........130.........140
Sequence VASVKDLANEASKYEIILQKGINQVGLKQYTQVVHKLDDMLEDIQSREENSEFHGILTHLEQLIKRSEAQ
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) S

SGGG
STTT
TTSSGGG




 .........150.........160.........170.........180.........190.........200.........210
Sequence LRVYFISILNSIKPFDPQINITKKMPFPYYEDQQLGALSWILDYFHGNSEGSIIQDILVGERSKLILKCM
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) T
S



TTS







SST
 .........220.........230.........240.........250.........260.........270.........280
Sequence AFLEPFAKEISTAKNAPYEKGSSGMNSYTEALLGFIANEKSLVDDLYSQYTESKPHVLSQILSPLISAYA
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TS



SSSSSS

S

SSS
S

TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence KLFGANLKIVRSNLENFGFFSFELVESINDVKKSLRGKELQNYNLLQDCTQEVRQVTQSLFRDAIDRIIK
Predicted secondary structure

SS confidence





































































Known secondary structure (DSSP) T
SSTTSS
STTS

SS


S
 .........360.........370.........380.........390.........400.........410.........420
Sequence KANSISTIPSNNGVTEATVDTMSRLRKFSEYKNGCLGAMDNITRENWLPSNYKEKEYTLQNWEDHNVLLS
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) T

S

SS



TTSST
S

GGGG

TT

GGGS




S
 .........430.........440.........450.........460.........470.........480.........490
Sequence CFISDCIDTLAVNLERKAQIALMPNQEPDVANPNSSKNKHKQRIGFFILMNLTLVEQIVEKSELNLMLAG
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) STTS



S
TT
SS
S
TSSSS
T
 .........500.........510.........520.........530.........540.........550.........560
Sequence EGHSRLERLKKRYISYMVSDWRDLTANLMDSVFIDSSGKKSKDKEQIKEKFRKFNEGFEDLVSKTKQYKL
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) TTTSSSSSSS
TT


 .........570.........580.........590.........600.........610.....
Sequence SDPSLKVTLKSEIISLVMPMYERFYSRYKDSFKNPRKHIKYTPDELTTVLNQLVR
Predicted secondary structure

















SS confidence






















































Known secondary structure (DSSP)



S
S
GGGT



TS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D