Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yfpF_

Fold library idPDB HeaderMoleculeTitle
c5yfpF_4.40PDB header: exocytosisChain: F: PDB Molecule: exocyst complex component sec15;


Added to library: Sat Feb 3 08:21:57 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VKHEPALGQNDVFDLDPLSFDKWVPFLRRALDKNQLDPVIDELENSIEDNFQGLELQLLQDSQMNDKLET
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)






TTSS
S


TTSSSTTSS
SST
S

S

 .........80.........90.........100.........110.........120.........130.........140
Sequence SIDEIANIQGMVQDTLSSEISKFQIRLSESANELIVKKQMYVNNKKISLKISEATILITKVVRILELSSK
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP) TTSSSSSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence CQELITERKFFKVLQNLDSLEKLYLQEFKNYNFQFLIEIYNSIPFLQKVTKDECINLIRNSLNLNLGKNL
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)

S

STTTTTGGG
S


SSTTS
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence IKVGQEFVAIYENELLPQWLETRSKMKLTNFKFNSPIEISMRDESFLAKLNLGEFFQLDDFHDSIMIFQN
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TS
SSS
SS
SS


TT
TTTTTTTTTTTTTTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence LNELSVLSGEFNKEYELRKTKLMYPLIWKKNKFTQSLSLHFLQDYFLKILGFLLYDINLNKATEFILVDN
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TTGGGTS

SS

S
TTT

GGGS

TTS

SS
SS
SSTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence NYNSTNEFWDGLMDRLSPYLSYFIDEKLKTEEDMIKLKDFLCIYVAILENFKLNIEPLYKILVSIFEKFC
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP)
STTGGGGGG
TTTTTTSSSS
SS

 .........430.........440.........450.........460.........470.........480.........490
Sequence SVSLRAFDDEFQILLNDDDFMPLSINDKTLYEKVLKICWLYPMTCTLAKKTYSKITAFLSIFYRHELHTL
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TTTTTTT









SSSTT


SST


SSS
SSTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence NNILVKTMDDIFNDIVNKKIRSKLESTSREEIAQILVNLDYFIIAAKEFSNFMTRENILQNPDMEIRLSS
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TTTS
SSTGGG


STTTTTTTTTTTTS


STTT

TT



T
 .........570.........580.........590.........600.........610.........620.........630
Sequence IKYLAESRKLAETKLIELIDSKISDDISIIDLAQFLEMMFASTLQNLPYSVQTLLIFREFDSLTRQFMGL
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) T









TTS
SSTTTTTTT
 .........640.........650.........660.........670.........680.........690.........700
Sequence LLHDTPSTITHESIMNFEVDVNYLESIMELKQCIELLKTQGKDYNEPEIRLRKYSRIRQEDAALLLSKIQ
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTS


S

SSSTTTSSGGG





TTTTTTTT

SSSS
SS
TTTTT
 .........710.........720.....
Sequence HFVSSVEGANGDDTSVMDSSSIFNS
Predicted secondary structure













SS confidence
























Known secondary structure (DSSP) TTTTSSS




TTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D