Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5y9dA_

Fold library idPDB HeaderMoleculeTitle
c5y9dA_2.50PDB header: oxidoreductaseChain: A: PDB Molecule: acyl-coenzyme a oxidase 1;


Added to library: Sat Jan 6 08:22:06 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TTNTFTDPPVEMAKERGKTQFTVRDVTNFLNGGEEETQIVEKIMSSIERDPVLSVTADYDCNLQQARKQT
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)


TTTT

S
TS
GGG

TTGGG

 .........80.........90.........100.........110.........120.........130.........140
Sequence MERVAALSPYLVTDTEKLSLWRAQLHGMVDMSTRTRLSIHNNLFIGSIRGSGTPEQFKYWVKKGAVAVKQ
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TT

TT
TS
TTTTTTSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence FYGCFAMTELGHGSNLKGLETTATYDQDSDQFIINTPHIGATKWWIGGAAHTSTHCVCFAKLIVHGKDYG
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)





BSS
SS
GGG


TTTT

SGGG
TTTTTT
STT
 .........220.........230.........240.........250.........260.........270.........280
Sequence TRNFVVPLRNVHDHSLKVGVSIGDIGKKMGRDGVDNGWIQFTNVRIPRQNMLMRYAKVSDTGVVTKPALD
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)
B
TTT

B
TT



SS
TTS

SSGGGB

SSSB

TTS


B

SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence QLTYGALIRGRVSMIADSFHVSKRFLTIALRYACVRRQFGTSGDTKETKIIDYPYHQRRLLPLLAYCYAM
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
TTSTT
B
S


TTS


BGGGS
 .........360.........370.........380.........390.........400.........410.........420
Sequence KMGADEAQKTWIETTDRILALNPNDPAQKNDLEKAVTDTKELFAASAGMKAFTTWGCAKIIDECRQACGG
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP)

TT
STTTTGG
 .........430.........440.........450.........460.........470.........480.........490
Sequence HGYSGYNGFGQGYADWVVQCTWEGDNNVLCLSMGRGLVQSALQILAGKHVGASIQYVGDKSKISQNGQGT
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) GGGSGGGSGGGGTSSS
TT



GGGGGGGS

S



SS

 .........500.........510.........520.........530.........540.........550.........560
Sequence PREQLLSPEFLVEAFRTASRNNILRTTDKYQELVKTLNPDQAFEELSQQRFQCARIHTRQHLISSFYARI
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP)
T
TTTS
T
 .........570.........580.........590.........600.........610.........620.........630
Sequence ATAKDDIKPHLLKLANLFALWSIEEDTGIFLRENILTPGDIDLINSLVDELCVAVRDQVIGLTDAFGLSD
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) TTS
TTTSTTSS
TTT


 .........640.........650.........660.........670.........680.......
Sequence FFINAPIGSYDGNVYEKYFAKVNQQNPATNPRPPYYESTLKPFLFREEEDDEICDLD
Predicted secondary structure























SS confidence
























































Known secondary structure (DSSP)

GGG
TT

S

S

S
TTTTTTT












Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D