Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5x7hA_

Fold library idPDB HeaderMoleculeTitle
c5x7hA_2.60PDB header: transferaseChain: A: PDB Molecule: cycloisomaltooligosaccharide glucanotransferase;


Added to library: Sat Apr 29 08:17:53 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MASGDVERVYTDKSRYDPGDPVTITAQVRNTDSIAWTGTVQLRIAHLEDQVHTASQTVTIGGGQTEDVQF
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


S
S
B
TT

SSS
TT
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence TWTSPATDFKGYLADIDAGALGSGTTAIDVSSDFARYPRYGYVSEFHPDETAAESAAKIDELAQDYKINA
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

SSSS
GGG

S
GGGS





TT




 .........150.........160.........170.........180.........190.........200.........210
Sequence WQFYDWMWRHETMIKRTGSAIDSTWIDLFNREISWQTIQNQIDAVHDQNGAAMAYAMIYAAREDYESYGV
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) TT

SSSSS
S
TT
S
TTS
TTT
SSTTGGGGT
 .........220.........230.........240.........250.........260.........270.........280
Sequence DSEWGIYQDPNHLQQLDVDFGNNSTYMYLFNPANTDWQSFIHAQYLDAINTAGFDGIHVDQMGQRNNVYD
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
GGGBSSTTS
SB

SSSS
B
TT


S





S
 .........290.........300.........310.........320.........330.........340.........350
Sequence YWGNPLNFPATFTPFINEAKSTLTANNSDKDRITYNIVDGTVDGWAANEVSGGADVDFLYSEIWHLSDSY
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TTS
B

GGGG
TTS
S

TT
TT


SS

SSS
B
 .........360.........370.........380.........390.........400.........410.........420
Sequence IQLKDYIDSLKANSGNKAVVLAAYMNYRENIGDRYEAESAALTNTATNNNHSGYTGSGFVDQFADPGDAV
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) TS



TTTT


S
STTSS


STT
STT



STT
 .........430.........440.........450.........460.........470.........480.........490
Sequence TFSITVPEEGYYSLVFRFANNSGFTATRNLYVDSAFEIELPFQNQPSWSAWSHETWHQVYLTPGTHTIKL
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) SSS

SSS
TT


SSTT


S
 .........500.........510.........520.........530.........540.........550.........560
Sequence AYDAGNVGAINLDSLTLGTFDPHSIRLANAMMAASGATHIELGEDSQMLAHEYYPNRSKSMRSELKEALK
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)

TT

S

B

TT
TTT

SSSTT

S
B

 .........570.........580.........590.........600.........610.........620.........630
Sequence QHYNFITAYENLLFDPDVVDNDSGSQFVNLDMVSASGDASPNTVWHQVKRTPEYNIVHFINLANNDNQWR
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TTSTT

SS
GGGTTS
SS

TTS
SS

TTS
SBSS
 .........640.........650.........660.........670.........680.........690.........700
Sequence NSANPPTLHTNIATKVYVSPDETISGVYLASPDHDDNRTQSLAYTTGTDIHGDYVAFTLPSLEYWSMVYM
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) S








SS


S


TTSGGG



TTSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D