Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wk1L_

Fold library idPDB HeaderMoleculeTitle
c5wk1L_3.60PDB header: virusChain: L: PDB Molecule: capsid stabilizing protein;


Added to library: Sat Jan 20 10:26:03 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MANSKNSIFVGGAGRVKQTIEGLAQSAFKPGQLLARAAGDAIDVTAKASTTYGNEFLICDDQPQTLGGGT
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)

S



S



SS




B
SS


TT
B
STTB



TT









GGGT

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence DVAVTAGDTVQAISVLPGQYVLLSFAATQNVTTKGAAVASNGDGNFKLGNPATEQTFAVTEEIINVTTAG
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) S



TTSB



TT

SS

STT

TTS



TTTS







STT
 ........
Sequence TLVLCRAI
Predicted secondary structure
SS confidence







Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D