Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wc4A_

Fold library idPDB HeaderMoleculeTitle
c5wc4A_1.20PDB header: transferaseChain: A: PDB Molecule: bis3 biphenyl synthase;


Added to library: Sat Dec 16 08:37:54 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QHAKILAIGTANPPNVYHQKDYPDFLFRVTKNEHRTDLREKFDRICEKSRTKKRYLHLTEEMLKANPNIY
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)




S
GGGTT
TT
S



S


GGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence TYGAPSLDVRQDICNIEVPKLGQEAALKAIKEWGQPISRITHLIFCTASCVDMPGCDFQLIKLLGLDPSV
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) STT
S

S
GGG

SS


SS
T

TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence TRTMIYEAGCYAGATVLRMAKDFAENNKGARVLVVCAEITTVFFHGLTDTHLDILVGQALFADGASAVIV
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) S

TTSTT


GGGG




TT
TB

 .........220.........230.........240.........250.........260.........270.........280
Sequence GANPEPEIERPLFEIVACRQTILPNSEHGVVANIREMGFNYYLSGDVPKFVGGNVVDFMTKTFEKVDGKK
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) SS

TTT




TT
TTSTT
TTTTTT


 .........290.........300.........310.........320.........330.........340.........350
Sequence KDWNSLFFSVHPGGPAIVDQVEEKLGLKEGKLRATRHVLSEYGNMGAPTVHFILDEMRNKSIEEGKTTTG
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) S
GGGS

SSTT

TTTT
B
STTT
SBTT
 .........360.........370.........
Sequence EGLEWGVVIGIGPGLTVETAVLRSESIRC
Predicted secondary structure










SS confidence




























Known secondary structure (DSSP) TT
STTT
B



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D