Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wc4A_

Fold library idPDB HeaderMoleculeTitle
c5wc4A_1.20PDB header: transferaseChain: A: PDB Molecule: bis3 biphenyl synthase;


Added to library: Sat Dec 16 08:37:54 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QHAKILAIGTANPPNVYHQKDYPDFLFRVTKNEHRTDLREKFDRICEKSRTKKRYLHLTEEMLKANPNIY
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)




S
GGGTT
TT
S



S


GGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence TYGAPSLDVRQDICNIEVPKLGQEAALKAIKEWGQPISRITHLIFCTASCVDMPGCDFQLIKLLGLDPSV
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) STT
S

S
GGG

SS


SS
T

TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence TRTMIYEAGCYAGATVLRMAKDFAENNKGARVLVVCAEITTVFFHGLTDTHLDILVGQALFADGASAVIV
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) S

TTSTT


GGGG




TT
TB

 .........220.........230.........240.........250.........260.........270.........280
Sequence GANPEPEIERPLFEIVACRQTILPNSEHGVVANIREMGFNYYLSGDVPKFVGGNVVDFMTKTFEKVDGKK
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) SS

TTT




TT
TTSTT
TTTTTT


 .........290.........300.........310.........320.........330.........340.........350
Sequence KDWNSLFFSVHPGGPAIVDQVEEKLGLKEGKLRATRHVLSEYGNMGAPTVHFILDEMRNKSIEEGKTTTG
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) S
GGGS

SSTT

TTTT
B
STTT
SBTT
 .........360.........370.........
Sequence EGLEWGVVIGIGPGLTVETAVLRSESIRC
Predicted secondary structure










SS confidence




























Known secondary structure (DSSP) TT
STTT
B



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D