Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5w78B_

Fold library idPDB HeaderMoleculeTitle
c5w78B_2.27PDB header: hydrolaseChain: B: PDB Molecule: acyloxyacyl hydrolase;


Added to library: Sat Jan 6 08:15:35 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DICSLPVLAKICQKIKLAMEQSVFPTLRGYHWRGRDCNDSDESVYPGRRPNNWDVHQDSNCNGIWGVDPK
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP)
GGGSGGGTT

GGGGSTTTB


S
TT
TT

TTB

GGGGSSS
TTSSS

SB
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence DGVPYEKKFCEGSQPRGIILLGDSAGAHFHISPEWITASQMSLNSFINLPTALTNELDWPQLSGATGFLD
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) T

BTTS



TTTTTB


GGGT
GGG

GGGGTTTTTTB
GGGSTTT

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence STVGIKEKSIYLRLWKRNHCNHRDYQNISRNGASSRNLKKFIESLSRNKVLDYPAIVIYAMIGNDVCSGK
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
SSS





GGGTT

TT

TTTGGGTGGG



TTTB



STTT


S
 .........220.........230.........240.........250.........260.........270.........280
Sequence SDPVPAMTTPEKLYSNVMQTLKHLNSHLPNGSHVILYGLPDGTFLWDNLHNRYHPLGQLNKDMTYAQLYS
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) SS
TTTS

TTS
TT



TTTSB
GGGTTTT

B
 .........290.........300.........310.........320.........330.........340.........350
Sequence FLNCLQVSPCHGWMSSNKTLRTLTSERAEQLSNTLKKIAASEKFTNFNLFYMDFAFHEIIQEWQKRGGQP
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) T

TTTTTSSS



SS


TT

G
 .........360.........370.........380.........390.........400......
Sequence WQLIEPVDGFHPNEVALLLLADHFWKKVQLQWPQILGKENPFNPQIKQVFGDQGGH
Predicted secondary structure


























SS confidence























































Known secondary structure (DSSP) GGGB
TTTSSSB

GGGT



TTTTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D