Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5w78B_

Fold library idPDB HeaderMoleculeTitle
c5w78B_2.27PDB header: hydrolaseChain: B: PDB Molecule: acyloxyacyl hydrolase;


Added to library: Sat Jan 6 08:15:35 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DICSLPVLAKICQKIKLAMEQSVFPTLRGYHWRGRDCNDSDESVYPGRRPNNWDVHQDSNCNGIWGVDPK
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP)
GGGSGGGTT

GGGGSTTTB


S
TT
TT

TTB

GGGGSSS
TTSSS

SB
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence DGVPYEKKFCEGSQPRGIILLGDSAGAHFHISPEWITASQMSLNSFINLPTALTNELDWPQLSGATGFLD
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) T

BTTS



TTTTTB


GGGT
GGG

GGGGTTTTTTB
GGGSTTT

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence STVGIKEKSIYLRLWKRNHCNHRDYQNISRNGASSRNLKKFIESLSRNKVLDYPAIVIYAMIGNDVCSGK
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
SSS





GGGTT

TT

TTTGGGTGGG



TTTB



STTT


S
 .........220.........230.........240.........250.........260.........270.........280
Sequence SDPVPAMTTPEKLYSNVMQTLKHLNSHLPNGSHVILYGLPDGTFLWDNLHNRYHPLGQLNKDMTYAQLYS
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) SS
TTTS

TTS
TT



TTTSB
GGGTTTT

B
 .........290.........300.........310.........320.........330.........340.........350
Sequence FLNCLQVSPCHGWMSSNKTLRTLTSERAEQLSNTLKKIAASEKFTNFNLFYMDFAFHEIIQEWQKRGGQP
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) T

TTTTTSSS



SS


TT

G
 .........360.........370.........380.........390.........400......
Sequence WQLIEPVDGFHPNEVALLLLADHFWKKVQLQWPQILGKENPFNPQIKQVFGDQGGH
Predicted secondary structure


























SS confidence























































Known secondary structure (DSSP) GGGB
TTTSSSB

GGGT



TTTTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D