Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5vafD_

Fold library idPDB HeaderMoleculeTitle
c5vafD_2.77PDB header: cell adhesionChain: D: PDB Molecule: accessory sec system protein asp1;


Added to library: Sat Feb 24 08:34:29 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MYYFIPSWSGSGKRVWHRDIIPWYRSMQRLEFDDTIHQIRIFHSENLPVKLLLQAYMPHARYFLHRQDIF
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)





SSS
TTB




GGG







TT


SB
TTTT
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence ETEYYSVFDEIQAVESNDMQVLQIKDLEWEDDCEFIYTPFLIIVRRQGQLYAHVEFGVEGFISFIKFFKD
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) T
T









TTSS


SS
B

B
SSSSSS
TTSST
 .........150.........160.........170.........180.........190.........200.........210
Sequence DQLEKLNIFDDRGFVSSIVYYEDGQEVCQDYLNPNGDWRIREYLKFENSHVVVNPVFSRDFDKLEYECMP
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) T
TTSSSSS

SSS

SSS



GGGGGG
S
SSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence DLILEKLGYYISHNVEEDSRFVVAAQPFTNQGVLDLLPQHSHSILSFFHERNQASNIENLKADLEYADLV
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) S

TT


SS

S
TT

TT

SSTT
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence LTDRMDFKETLQNYFPLQAEKIHYLSPFDTRLQLGKSQQRHESKIFYQIDLSELLNDYAIFKVLFYVAQH
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) S

TTTGGG

SS







GGG
SS

SSS


T
 .........360.........370.........380.........390.........400.........410.........420
Sequence PDTELVIGVYNAWQEGIKQVENKVEELISDYLDLKDFIKKSLEYRFRIRNITDELSLIQELDDTRLIIDL
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TTS

S
GGGGB




BS
ST


 .........430.........440.........450.........460.........470.........480.........490
Sequence SQQPNLYTQIAGISAGIPQINLVASDYVTHLQNGYILDSISQLAVAADYYLQGLKNWNQALIYSIEKIKL
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) SSS

T

SS

SSS
BTTT
S
GGGSSSTT
 .........500.........510.
Sequence NTGHQVIKRWEKWLKEAIDEK
Predicted secondary structure


SS confidence




















Known secondary structure (DSSP) SSSTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D