Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5t5oC_

Fold library idPDB HeaderMoleculeTitle
c5t5oC_2.75PDB header: sugar binding proteinChain: C: PDB Molecule: lectin;


Added to library: Sat Feb 11 00:28:26 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SELSFNYPNFQSVEDITFQGGASPRNETLQLTPTDSNGIPIRQRAGHAVYSQPFQLRDTSFYTTFTFVIR
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)

SS
S

TTT
TT
S
B
TTS
B
SS
SS

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence TTSNSPADGFAIFIAPPDFPVKRYGGYLGLFEPNTATNTSANKVVAVEFDTWVNTEWKEPRYRHIGIDVN
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) SSSS

TT





GGGTTT

TTTTT
GGG



S

TTTT

SS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence SIVSVRVTRWQDKDVFSRSIATAHVGYDGISKILTAFVTYPDGGNYVLSHVVDLAEIFPGDVRIGFSGAT
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) SSS
S

TT


TTTT
TTS



SS
 .........220.........
Sequence GQYETQYIHSWSFSSTSTN
Predicted secondary structure







SS confidence


















Known secondary structure (DSSP) S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D