Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5sy5B_

Fold library idPDB HeaderMoleculeTitle
c5sy5B_3.20PDB header: transcriptionChain: B: PDB Molecule: neuronal pas domain-containing protein 1;


Added to library: Thu Feb 9 12:09:32 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NAARWRRGKENLEFFELAKLLPLPGAISSQLDKASIVRLSVTYLRLRRFAALGAPPWGEQHLGGHILQSL
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)
SSS
TT

SSSS





S
 .........80.........90.........100.........110.........120.........130.........140
Sequence DGFVFALNQEGKFLYISETVSIYLGLSQVELTGSSVFDYIHPGDHSEVLEQLGLQERSFFVRMKSTLGYK
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) S
SS
B
TTT


TTSBGGGTB
TTST





 .........150.........160.........170.........180.........190.........200.........210
Sequence VIHVTGRLRALGLVALGHTLPELPLHGHMIVFRLSLGLTILACESRVSDHMDMGPSELVGRSCYQFVHGQ
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)












TT
TT
B
GGGGGTSS

TTSBB
TT
 .........220.........230.........240.........250.........260.........270........
Sequence DATRIRQSHLDLLDKGQVVTGYYRWLQRAGGFVWLQSVATVAHHVLWVSHVLSNAEGSQTPLDAFQLP
Predicted secondary structure















SS confidence



































































Known secondary structure (DSSP) TS

S
SSS




SS
BS
SS

SSTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D