Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5onuB_

Fold library idPDB HeaderMoleculeTitle
c5onuB_2.22PDB header: membrane proteinChain: B: PDB Molecule: outer membrane protein ompu;


Added to library: Sat Jan 6 08:17:48 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GINQSGDKAGSTVYSAKGTSLEVGGRAEARLSLKDGKAQDNSRVRLNFLGKAEINDSLYGVGFYEGEFTT
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)

STTS



TTTT

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence NDQGKNASNNSLDNRYTYAGIGGTYGEVTYGKNDGALGVITDFTDIMSYHGNTAAEKIAVADRVDNMLAY
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

TTS




TT
SSTTT


SSS


S



GGGSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence KGQFGDLGVKASYRFADRNAVDAMGNVVTETNAAKYSDNGEDGYSLSAIYTFGDTGFNVGAGYADQDDQN
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP) TT



TT

B

GGG
S




SSSSTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence EYMLAASYRMENLYFAGLFTDGELAKDVDYTGYELAAGYKLGQAAFTATYNNAETAKETSADNFAIDATY
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTTTTTTT
 .........290.........300.........310.........320
Sequence YFKPNFRSYISYQFNLLDSDKVGKVASEDELAIGLRYDFH
Predicted secondary structure















SS confidence







































Known secondary structure (DSSP) TT


SSSS
SGGG




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D