Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ogiB_

Fold library idPDB HeaderMoleculeTitle
c5ogiB_2.80PDB header: viral proteinChain: B: PDB Molecule: scfv of 9c12 antibody;


Added to library: Sat Feb 10 08:50:01 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DYKDDDDKDIVMTQSPSSLSASVGDRVTITCKASQSVTNDAAWYQKKPGKAPKLLIYQASTRYTGVPSRF
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)





SS



S
TT

SS

TT

SSS

TTT
TT

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence SGSGYGTDFTLTISSLQPEDFATYFCHQDYSSPLTFGQGTKVEIKRQVQLVQSGAEDKKPGASVKVSCKV
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TTSS

GGG
S
SSSS











TT

 .........150.........160.........170.........180.........190.........200.........210
Sequence SGFSLGRYGVHWVRQAPGQGLEWMGVIWRGGTTDYNAKFQGRVTITKDDSKSTVYMELSSLRSEDTAVYY
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) SS
TTT


TTS

TTS

GGGTT
TTTT
S

GGG
 .........220.........230...
Sequence CARQGSNFPLAYWGQGTLVTVSS
Predicted secondary structure







SS confidence






















Known secondary structure (DSSP)
SSSS





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D