Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ogiB_

Fold library idPDB HeaderMoleculeTitle
c5ogiB_2.80PDB header: viral proteinChain: B: PDB Molecule: scfv of 9c12 antibody;


Added to library: Sat Feb 10 08:50:01 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DYKDDDDKDIVMTQSPSSLSASVGDRVTITCKASQSVTNDAAWYQKKPGKAPKLLIYQASTRYTGVPSRF
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)





SS



S
TT

SS

TT

SSS

TTT
TT

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence SGSGYGTDFTLTISSLQPEDFATYFCHQDYSSPLTFGQGTKVEIKRQVQLVQSGAEDKKPGASVKVSCKV
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TTSS

GGG
S
SSSS











TT

 .........150.........160.........170.........180.........190.........200.........210
Sequence SGFSLGRYGVHWVRQAPGQGLEWMGVIWRGGTTDYNAKFQGRVTITKDDSKSTVYMELSSLRSEDTAVYY
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) SS
TTT


TTS

TTS

GGGTT
TTTT
S

GGG
 .........220.........230...
Sequence CARQGSNFPLAYWGQGTLVTVSS
Predicted secondary structure







SS confidence






















Known secondary structure (DSSP)
SSSS





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D