Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ngwA_

Fold library idPDB HeaderMoleculeTitle
c5ngwA_2.40PDB header: hydrolaseChain: A: PDB Molecule: opgh99a;


Added to library: Sat Feb 3 08:20:18 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FGPEDTFLGSPIPIFEVNEDYNVGAFYKFPNWNLNYNEMPVSGTYTAANTDQFPTHIRQANKAGINFFLF
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)



SS







S






TTS

SS
BTT



TT

TT

 .........80.........90.........100.........110.........120.........130.........140
Sequence DLVSSQNAGGHSSSFDIVARYNNELAGFTPDSIVKYAFNYNYGPLGINNNNPVDSTTDETTNTLDPKEIV
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)
TTSTTS
GGG


GGG

BTTB
TTTT
BGGGTB

 .........150.........160.........170.........180.........190.........200.........210
Sequence FQQDFLNIADLAENNTNYYRLDGKPVVYILNAQNLAANDSPAVFNRMRQAVRDAYNGMELYIIGMQPQWQ
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
TTB
TTTTGGG


S
TTT



SSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence PPLRYDFRFVGAVDAVTHNTYMQLNENNSYERILYFDKMVYGAWSYSQEALGRSEFNLEYIPTISPSSNY
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)
TTTTTTT
S

TT

BSSS
TTSTTT




S
B
T
 .........290.........300.........310.........320.........330.........340.........350
Sequence KLQNPNNQNYIFEKNEKLFRSVCNAARGAVGESKMVLLESFNNWNIGTQIEESNELKVDGVTPAYGDQYL
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) TTT
TT

B

B


TT

TT
S
SS
GGGT


S
B
SB
TTSSSB

TT
 .........360
Sequence KILKEEFKVA
Predicted secondary structure


SS confidence









Known secondary structure (DSSP) S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D