Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5nfiB_

Fold library idPDB HeaderMoleculeTitle
c5nfiB_2.51PDB header: cell adhesionChain: B: PDB Molecule: minor fimbrium anchoring subunit mfa2;


Added to library: Sat Feb 10 08:28:10 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence CPRGVYVNFYSQTECAENPSYPAEVARLNVYAFDKDGILRSANVFEDVQLSAAKEWLIPLEKDGLYTIFA
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

B

SS
SS
B

TT



TTSB
S



TT


S
 .........80.........90.........100.........110.........120.........130.........140
Sequence WGNIDDHYNIGEIKIGETTKQQVLXRLKQDGKWATNIDGTTLWYATSPVVELKNXEDGADQYIHTRANLR
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)


TT



TTT
BTTS
TT


TT







TTSS

SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence EYTNRVTVSVDSLPHPENYEIKLASSNGSYRFDGTVAKADSTYYPGETKVVGDSTCRAFFTTLKLESGHE
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

S
SSGGGS
SSSS
B







SSS
S


SSS
 .........220.........230.........240.........250.........260.........270.......
Sequence NTLSVTHKPTGREIFRTDLVGAILSQNINLRCINDFDIRLVAHHCNCPDDTYVVVQIWINGWLIHSY
Predicted secondary structure

























SS confidence


































































Known secondary structure (DSSP) TTTTT




TTT



STT

TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D