Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5nfiB_

Fold library idPDB HeaderMoleculeTitle
c5nfiB_2.51PDB header: cell adhesionChain: B: PDB Molecule: minor fimbrium anchoring subunit mfa2;


Added to library: Sat Feb 10 08:28:10 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence CPRGVYVNFYSQTECAENPSYPAEVARLNVYAFDKDGILRSANVFEDVQLSAAKEWLIPLEKDGLYTIFA
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

B

SS
SS
B

TT



TTSB
S



TT


S
 .........80.........90.........100.........110.........120.........130.........140
Sequence WGNIDDHYNIGEIKIGETTKQQVLXRLKQDGKWATNIDGTTLWYATSPVVELKNXEDGADQYIHTRANLR
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)


TT



TTT
BTTS
TT


TT







TTSS

SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence EYTNRVTVSVDSLPHPENYEIKLASSNGSYRFDGTVAKADSTYYPGETKVVGDSTCRAFFTTLKLESGHE
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

S
SSGGGS
SSSS
B







SSS
S


SSS
 .........220.........230.........240.........250.........260.........270.......
Sequence NTLSVTHKPTGREIFRTDLVGAILSQNINLRCINDFDIRLVAHHCNCPDDTYVVVQIWINGWLIHSY
Predicted secondary structure

























SS confidence


































































Known secondary structure (DSSP) TTTTT




TTT



STT

TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D