Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5nf2A_

Fold library idPDB HeaderMoleculeTitle
c5nf2A_1.73PDB header: cell adhesionChain: A: PDB Molecule: minor fimbrium subunit mfa1;


Added to library: Sat Feb 10 08:28:32 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PGEWAGKDKIEKVSIYMVPQGGPGLVESAEDLDFGTYYENPTIDPATHNAILKPKKGIKVNSAVGKTVKV
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

GGG




SSS


B


TTTT
BSS



GGGTTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence YVVLNDIAGKAKALLANVNAADFDAKFKEIIELSTQAQALGTVADGPNPATAAGKIAKKNGTTDETIMMT
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)

TTSTT

TTSSS
TTTT


GGG
SS


TGGGSTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence CLQPSDALTIEAKVTVERSVARAMVSTKAQSYEIKATTQIGEIAAGSVLATITDIRWVVAQGERRQYLSK
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
SS






S
S
S

SS
BTTB
TTS
SSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence KRGTVPENTWVTPGSGFVPTSSTFHTNATEYYDYAGLWEDHNTNEAVISGTQVPTLADYQLQDVTGELAN
Predicted secondary structure






























































SS confidence





































































Known secondary structure (DSSP)
SSTT
S
TTTT



TTGGGT
GGGGTT

S
TTS

S

BTGGGG
SS

 .........290.........300.........310.........320.........330.........340.........350
Sequence ALSGKFLLPNTHKSGANAASSDYKRGNTAYVLVRAKFTPKKEAFIDRGKTYSDNTAVPEYVAGEDFFVGE
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) T


B




SSTTT



TTTS

GGGBTTTT
B
TTS
B




TTS
T
 .........360.........370.........380.........390.........400.........410.........420
Sequence NGQFYVSMKSVTDPKVGGVAGMKAHKYVKGKVLYYAWLNPSTTSPDSWWNSPVVRNNIYHIHIKSIKKLG
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TS
SST
GGGT

TT

GGGSS
BS
SSS


B

B
TT

S

 .........430.........440.........450.........460.........470.........480.....
Sequence FNWNPLVPDPDPSNPENPNNPDPNPDEPGTPVPTDPENPLPDQDTFMSVEVTVLPWKVHSYEVDL
Predicted secondary structure


















































SS confidence
































































Known secondary structure (DSSP) BSS


S

SSTTSS

TT
SS


S
TT


S

TTS
S

SS
S

SS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D