Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5nf2A_

Fold library idPDB HeaderMoleculeTitle
c5nf2A_1.73PDB header: cell adhesionChain: A: PDB Molecule: minor fimbrium subunit mfa1;


Added to library: Sat Feb 10 08:28:32 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PGEWAGKDKIEKVSIYMVPQGGPGLVESAEDLDFGTYYENPTIDPATHNAILKPKKGIKVNSAVGKTVKV
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

GGG




SSS


B


TTTT
BSS



GGGTTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence YVVLNDIAGKAKALLANVNAADFDAKFKEIIELSTQAQALGTVADGPNPATAAGKIAKKNGTTDETIMMT
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)

TTSTT

TTSSS
TTTT


GGG
SS


TGGGSTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence CLQPSDALTIEAKVTVERSVARAMVSTKAQSYEIKATTQIGEIAAGSVLATITDIRWVVAQGERRQYLSK
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
SS






S
S
S

SS
BTTB
TTS
SSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence KRGTVPENTWVTPGSGFVPTSSTFHTNATEYYDYAGLWEDHNTNEAVISGTQVPTLADYQLQDVTGELAN
Predicted secondary structure






























































SS confidence





































































Known secondary structure (DSSP)
SSTT
S
TTTT



TTGGGT
GGGGTT

S
TTS

S

BTGGGG
SS

 .........290.........300.........310.........320.........330.........340.........350
Sequence ALSGKFLLPNTHKSGANAASSDYKRGNTAYVLVRAKFTPKKEAFIDRGKTYSDNTAVPEYVAGEDFFVGE
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) T


B




SSTTT



TTTS

GGGBTTTT
B
TTS
B




TTS
T
 .........360.........370.........380.........390.........400.........410.........420
Sequence NGQFYVSMKSVTDPKVGGVAGMKAHKYVKGKVLYYAWLNPSTTSPDSWWNSPVVRNNIYHIHIKSIKKLG
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TS
SST
GGGT

TT

GGGSS
BS
SSS


B

B
TT

S

 .........430.........440.........450.........460.........470.........480.....
Sequence FNWNPLVPDPDPSNPENPNNPDPNPDEPGTPVPTDPENPLPDQDTFMSVEVTVLPWKVHSYEVDL
Predicted secondary structure


















































SS confidence
































































Known secondary structure (DSSP) BSS


S

SSTTSS

TT
SS


S
TT


S

TTS
S

SS
S

SS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D