Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5necA_

Fold library idPDB HeaderMoleculeTitle
c5necA_2.30PDB header: membrane proteinChain: A: PDB Molecule: tonb-dependent siderophore receptor;


Added to library: Sat Feb 10 10:47:26 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DETTYNVDRSASKKYTAPLLDTPRSVTVVPKQVIKDTAAVSLQDALRTVPGITFGANPTGDRPFIRGFDA
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
TT
S


S
SSTT

S
STT
SS

TT

STTSTT


S

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence QSDTYVDGVRDTQTREIFNLEQIEVSKGPNSAFGGSLNLVSKQAKAGNFIDGGFTYGSDQTRRYTLDLNQ
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TT
TT






TT
S

TT






SS
TT

 .........150.........160.........170.........180.........190.........200.........210
Sequence EFLDGNAAFRLNLLKHDANVAGRDEVDVSRWGVAPSLTFGLGSPTRVTVSHYHLESDDTPDSGIPYAKSS
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TTTTTT
TTSSB



B


T
 .........220.........230.........240.........250.........260.........270.........280
Sequence DRSKHNPDKPVNVDRGNFYGLTGRDFQKSRIDTSTITVEHDLTDSLTIRNTSRYGNSHQDYLWTQPDDSQ
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) T
SSSS
B
B



TT


S
TTT
SSSS
TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence GNINNGSVWRRQNNRVSTTTTAVNQTDLFGEFYLGGFKNSFSTGLEFSREDSKRDGYIVDTNTGLGSNKC
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP) SGGGGTTT




SSTTT

 .........360.........370.........380.........390.........400.........410.........420
Sequence NPSLIGAPSGYNCTSLENPNPHDPWNGSITRKYAPLNTVGTTKAIYAFDTIDLNEQWQVNIGARFDSFET
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP)
TTTTTGGGTT
SSS

TT









TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence TAKNHGVRPATKLSDKSSFWNWQAGLVWKPVPNGSIYASYATSAETTNYELGTKWAFFNERLELSAAIFR
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTSSS

SSTT

TTTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence TDKDNTQSRVDGVELSASGKLTEKWKVFAGYSYLDSELVSNNGNEMPNTPKNSFSLWTTYDIFPKTTIGG
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) S


SSSS


TT


TT

STT
 .........570.........580.........590.........600.........610.........620.........630
Sequence GAFYVDKVYGDVGNTVYVPDYWRYDAMASYKLSKNVDFQLNVQNVFDKKYFDKAYAAHYASQAAGRTILF
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

SSTT

B

SSSSSTT




SSS



 .......
Sequence STNFHFL
Predicted secondary structure
SS confidence






Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D