Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5nclA_

Fold library idPDB HeaderMoleculeTitle
c5nclA_3.15PDB header: signaling proteinChain: A: PDB Molecule: serine/threonine-protein kinase cbk1;


Added to library: Sat May 19 09:35:53 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MYFERRPDLLTKGTQDKAAAVKLKIENFYQSSVKYAIERNERRVELETELTSHNWSEERKSRQLSSLGKK
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)






SS

SSSSTTTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence ESQFLRLRRTRLSLEDFHTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKSDSPWVVSLYYSFQ
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)



TTSS
SS

TTS


TTTS





TTB

 .........150.........160.........170.........180.........190.........200.........210
Sequence DAQYLYLIMEFLPGGDLMTMLIRWQLFTEDVTRFYMAECILAIETIHKLGFIHRAIKPDNILIDIRGHIK
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
SS

TT
BS


TT






STT
TTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LSDFGLSTGFHKTHDSNYYSISLTMSNRQQIQTWRKSRRLMAYSTVGTPDYIAPEIFLYQGYGQECDWWS
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP)


SSSS




S










SSTTTTT



STT

SSS


TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence LGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQFPDDIHISYEAEDLIRRLLTHADQRLGRHGGADEI
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) SS
TT

SST



S




TTSS
GGGSTTTSS
SSTT
 .........360.........370.........380.........390.........400.........410........
Sequence KSHPFFRGVDWNTIRQVEAPYIPKLSSITDTRFFPTDELENVPDSPAMLPFIGYTYSRFDYLTRKNAL
Predicted secondary structure



























































SS confidence



































































Known secondary structure (DSSP) TTSTTT

S
SSGGGGS

S




SSSS
GGGS







TT





S





TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D