Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5n81B_

Fold library idPDB HeaderMoleculeTitle
c5n81B_1.60PDB header: ligaseChain: B: PDB Molecule: tyrocidine synthase 1;


Added to library: Sat Dec 16 14:26:20 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LVPYAQGKSIHQLFEEQAEAFPDRVAIVFENRRLSYQELNRKANQLARALLEKGVQTDSIVGVMMEKSIE
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)




TT

STTSTTTTT

TT



SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence NVIAILAVLKAGGAYVPIDIEYPRDRIQYILQDSQTKIVLTQKSVSQLVHDVGYSGEVVVLDEEQLDARE
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TT


TTS
T
S
TT

SGGG


TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence TANLHQPSKPTDLAYVIYTSGKPKGTMLEHKGIANLQSFFQNSFGVTEQDRIGLFASMSFDVSVSEMFMA
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
S






TTS






TT

S
TTST
 .........220.........230.........240.........250.........260.........270.........280
Sequence LLSGASLYILSKQTIHDFAAFEHYLSENELTIITLPPTYLTHLTPERITSLRIMITAGSASSAPLVNKWK
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTT



TT


TT

GGG
TT
SSS


T
 .........290.........300.........310.........320.........330.........340.........350
Sequence DKLRYINAYGPTECLVATIWEAPSNQLSVQSVPIGKPIQNTHIYIVNEDLQLLPTGSEGELCIGGVGLAR
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) TTS

TTTS



SS



S



B
TT
TT

B

TT

TT


 .........360.........370.........380.........390.....
Sequence GYWNRPDLTAEKFVDNPFVPGEKMYRTGDLAKWLTDGTIEFLGRI
Predicted secondary structure
























SS confidence












































Known secondary structure (DSSP) TT

TTSTT

TTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D