Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5m64M_

Fold library idPDB HeaderMoleculeTitle
c5m64M_4.60PDB header: transcriptionChain: M: PDB Molecule: dna-directed rna polymerase i subunit rpa49;


Added to library: Sat Feb 11 00:15:00 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SEIEIESVQDQPSVAVGSFFKGFRAPSDTTFDLYKKKEKDEFVLHGENERLEYEGYTDSSSQASNQYVVG
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)



B



SS





S






S







S




SS
B


SSS
TT



 .........80.........90.........100.........110.........120.........130.........140
Sequence LFNPEKKSIQLYKAPVLVSKVVSKSSKNLRGTSNDRPTPLANIDATDVEQIYPIESIIPKKELQFIRVSS
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)


TTT

B





B










S

SS



SS
SSTTTSS
GGGTS
TT


TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence ILKEADKEKKLELFPYQNNSKYVAKKLDSLTQPSQMTKLQLLYYLSLLLGVYENRRVNNKTKLLERLNSP
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TTT


TTTTTSSSS


SS
GGG

SGGGTTT

STTSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence PEILVDGILSRFTVIKPGQFGRSKDRSYFIDPQNEDKILCYILAIIMHLDNFIVEITPLAHELNLKPSKV
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
S




S





TTT
TT

 .........290.........300.........310.........320...
Sequence VSLFRVLGAIVKGATVAQAEAFGIPKSTAASYKIATMKVPFKL
Predicted secondary structure

















SS confidence










































Known secondary structure (DSSP) T


T

GGGTTTS

SS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D