Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5lc5D_

Fold library idPDB HeaderMoleculeTitle
c5lc5D_4.35PDB header: oxidoreductaseChain: D: PDB Molecule: nadh dehydrogenase [ubiquinone] iron-sulfur protein 2,


Added to library: Thu Feb 9 21:05:33 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QPDVEWAEQYGGAVMYPTKETAHWKPPPWNDVDPPKDTLVSNLTLNFGPQHPAAHGVLRLVMELSGEMVR
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)


STTSTTTSS

SS







TTS





S




B

SS

SS
SS


SSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence KCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIRPPPRAQWIRVLFGEI
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)



TT


TTS
TTTSTTSSS
SSSTTTT



TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence TRLLNHIMAVTTHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYVRPGGVHQDLPLGLMDDIYEF
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) TT

SSSSS

TTTTSS


TTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence SKNFSLRIDELEEMLTNNRIWRNRTVDIGIVTAEDALNYGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFD
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TTTTSSTTTSS


STT


SSTTTTBS



S
SSS
SSS


 .........290.........300.........310.........320.........330.........340.........350
Sequence VPIGSRGDCYDRYLCRVEEMRQSIRIISQCLNKMPPGEIKVDDAKVSPPKRAEMKTSMESLIHHFKLYTE
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)


BSS
STTTS





SS
S
TTTS



TSSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence GYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIV
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
S



S

SSS


SSSS



TTTTTB
T

 ......
Sequence FGEVDR
Predicted secondary structure





SS confidence





Known secondary structure (DSSP) TTSTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D