Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5kdiA_

Fold library idPDB HeaderMoleculeTitle
c5kdiA_1.45PDB header: lipid transportChain: A: PDB Molecule: pleckstrin homology domain-containing family a member 8;


Added to library: Sat Dec 16 08:23:55 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PTFFSTMNTSFSDIELLEDSGIPTEAFLASCYAVVPVLDKLGPTVFAPVKMDLVGNIKKVNQKYITNKAK
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
BGGGSTTT
GGG


BGGGB
BTT
TTTTTT
TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence FTTLQKIVLHEVEADVAQVRNSATEALLWLKRGLKFLKGFLTEVKNGEKDIQTALNNAYGKTLRQHHGWV
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)
SBTT
TTSTT
TT


TGGGG

 .........150.........160.........170.........180.........190.........200.........210
Sequence VRGVFALALRAAPSYEDFVAALTVKEGDHQKEAFSIGMQRDLSLYLPAMEKQLAILDTLYEVHGLESDEV
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) T


TTBSSTTGGGSTT





 .
Sequence V
Predicted secondary structure
SS confidence
Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D