Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5jldA_

Fold library idPDB HeaderMoleculeTitle
c5jldA_2.20PDB header: ligaseChain: A: PDB Molecule: arginyl-trna synthetase, putative;


Added to library: Thu Feb 9 14:04:36 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AITMECITKKIKTIFQNSIQKCFPSISEDAIVTYANLKFGHYQCNNAINIYKKYGKELNYENAQKISEFI
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)





STT







TTT
S
TTTTT
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence ISNINETIFEEIKSSPQGFITVKLSKDYIETSLKKLFNGEKIDISININDIKESNENYGNVLVDFSSPNI
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) T


TT

SS


TTT




GGGGS
TT


S



BT
 .........150.........160.........170.........180.........190.........200.........210
Sequence AKEMHVGHLRSTIIGDSICRVFEFLKINTHRVNHVGDWGTQFGMIINYIKTHYPNFKEEMPDLSNLTSLY
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TS


TT


B
S
TTT
GGGTTS



TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence QESKKMYKENAIKLQNNDEDCKFVWNKLCESSKKEFDKLYNILDIKLEYVGESFYVPMLSTVLDLLKESK
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)

TT
TT




GGGGGGGT
 .........290.........300.........310.........320.........330.........340.........350
Sequence LLTNIGDAICYQSENFKVPLFLQKSNGGYGYDSTDVAALYYRLTQLNCNCVIYVTDIGQLTHFETIFDLI
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

TT

SS
SS

SSSSB
TTTS

SGGG
 .........360.........370.........380.........390.........400.........410.........420
Sequence KKTNWGDKNAKLMHVGFGFVLVKLINLIKEGTERAKRDLLQRIETYFENVDIDQLSESLCVSAIKYFDLK
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TS

S
TT


B


T

GGGS
T
 .........430.........440.........450.........460.........470.........480.........490
Sequence QHRNSDYKFSYDNMLNVKGNTGIYIIYGYSRICSIFRKSTINVEDISKDELSLTSIYEINLGLHILKFPD
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) S
TTS
B



TTSSS
SS
GGG

GGG



ST
 .........500.........510.........520.........530.........540.........550.........
Sequence IFYYILKNMLVHKLAEYMYDLTTTFTAFYENCKVLNNENEKSRLLLCSITKSLLKLCMELLGMKPIEKL
Predicted secondary structure


















SS confidence




































































Known secondary structure (DSSP)

TTTS
GGGTT



S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D