Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5jk5A_

Fold library idPDB HeaderMoleculeTitle
c5jk5A_2.07PDB header: oxidoreductaseChain: A: PDB Molecule: phenylalanine-4-hydroxylase;


Added to library: Sat Apr 29 08:21:21 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QSYHSSIFFSISKGSDKIGGLLEYLEIIKKHNINITRIESRPSKTEKKDYDFFLDLEYPTENNKEVEKVI
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

TT
TT
TT
SS
TTSSTT
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence KDLEEKGVKATTLQESSNQTYAPWFPRKISDLDLFANKVLEMGSDLTSDHPGASDPVYRERRREIAKIAS
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TTT




SS
SS



BGGGGGGGTT


SSSSS

TTSTTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence TYKHGDEIPRIDYTEEEIKTWGVVYNRLKELFPTNACHQHAYIFPLLEQNCGYSPDNIPQLQDISNFLQE
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

TTS







TTB
S

BTTB


 .........220.........230.........240.........250.........260.........270.........280
Sequence CTGWRIRPVQGLLSARDFLNGLAFRVFHATQYIRHPSVPLYTPEPDCCHELLGHVPLLADPDFADFSQEI
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) S

SS


TTT





TT
TT

SS

TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence GLASIGASDEDIQLLSTCYWFTVEFGLCKEGDTIRAYGAGILSSTGEMEHFLTDKAKKLPFNPFDACNTE
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TT

TTTTT
TT

T
TSTTS

TT

 .........360.........370.........380.........390.........400
Sequence YPITTFQPLYYVAESFQKAKEQMRQFADSFKKPFSIRYNPYTQSIEILDN
Predicted secondary structure

























SS confidence

















































Known secondary structure (DSSP)

SSS

SS
S

STTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D