Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ergB_

Fold library idPDB HeaderMoleculeTitle
c5ergB_2.20PDB header: transferaseChain: B: PDB Molecule: trna (adenine(58)-n(1))-methyltransferase catalytic subunit


Added to library: Thu Feb 9 14:15:36 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NCFSGYKDLIKEGDLTLIWVSRDNIKPVRMHSEEVFNTRYGSFPHKDIIGKPYGSQIAIRTFAFVHVLQP
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
TTSS


B

TT
TT

TT
TTGGGTTTSBTT




 .........80.........90.........100.........110.........120.........130.........140
Sequence TPELWTLSLPHRTQIVYTPDSSYIMQRLNCSPHSRVIEAGTGSGSFSHAFARSVGHLFSFEFHHIRYEQA
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
S
TTSS


TT
STT


TTS
SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence LEEFKEHGLIDDNVTITHRDVCQGGFLIKKGDTTSYEFGNNETAASLNANVVFLDLPAPWDAIPHLDSVI
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) TSTTTT


S

BTTSSB




TT
SB



BS
SS
GGGTGGGGGGTB
 .........220.........230.........240.........250.........260.........270.........280
Sequence SVDEKVGLCCFSPCIEQVDKTLDVLEKYGWTDVEMVEIQGRQYESRRQMVRSLNDALERLRDIKRHKIKE
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
SSS
SSTT









T


T
 .........290.........300.........310.........320....
Sequence GDSNYKWKEVTKMEAEIKSHTSYLTFAFKVVNRSRDDEKVNEIL
Predicted secondary structure





























SS confidence











































Known secondary structure (DSSP) T
TTS

SS



S

S




T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D