Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5do0A_

Fold library idPDB HeaderMoleculeTitle
c5do0A_2.60PDB header: transferaseChain: A: PDB Molecule: protein lysine methyltransferase 1;


Added to library: Thu Feb 9 16:30:37 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence YESYPYAITNPYHLSTLATLFGINAPEVENSKILELGCAAGGNLIPHAVLYPNAHFVGVDLSKVQIDEAN
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)





GGG
T




STT
S
TT
TTT
TTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence KNVRALGLKNIEFHHCSITDIDDSFGKFDYIICHGVISWVPKIVRDKIFKVCNRNLSTNGIAYISYNTLP
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TT
SSS
GGG

STT


S
GGGS
TBTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence GWNMVRTIRDMMLYHSSDRIAQSRLLLEFVKDSLEHSKTPYAEVLKTEAGLLAKQTDHYLRHDHLEEENA
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TT

TTT

SS
SSS

STTTS



 .........220.........230.........240.........250.........260.........270.........280
Sequence QFYFHEFMNEARKHNLQYLADCNISTMYLGNMPPKVVEQLKAVNDIVRTEQYMDFITNRRFRTTLLCHND
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
B
TTSSGGGG


SS
S

T

TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence LKINRNINNDDIKKFNIIFNVIPEKPLKEVDLNNATENLQFFLNGNKESNLSTTSPYMKAILYTFSENLN
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) S






GGGGGGS


SS
STT

TT
SS

SSSSSSS

STT
 .........360.........370.........380.........390.........400.........410.........420
Sequence NPLSFKQVTSEANTKLNNTKLNEIKNELLNNAMKLVLQGYISITNQKHRSKPVLDKPKTTQMVIYQAKYT
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) S
TTTS
TTSSS








SS

B

 .........430.........440.........450.........460.........470.........480.........490
Sequence PSMWVTNLKHEPIGVNFFEKFALRYMDGRNDKKAIIEAILGHVEKGELTLSREGQKIENKEEIRKELESL
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)

S
TTS


TTTTT


S



SSSS


TTTTSSS
 .........500.....
Sequence FTPMIEKFCSNALLV
Predicted secondary structure



SS confidence














Known secondary structure (DSSP) TT
B


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D