Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5cxpA_

Fold library idPDB HeaderMoleculeTitle
c5cxpA_1.77PDB header: hydrolaseChain: A: PDB Molecule: possible xylan degradation enzyme (glycosyl hydrolase


Added to library: Thu Feb 9 16:12:20 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SNDATINVAAKHQTIRGFGASSAWCGALSDTCMDTLYKNAGLDILRVRIAPNEGWNRGDYRAWADELSNA
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)





TT

S

TTS





TTGGGT

GGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence KKVRARGGIVFATPWTPPASMKTNNTTTGANKGSLKPSSYAAYAAYLKTFVKYMSDNGAPLYALSLQNEP
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TT
S


GGGBTTSSSB
GGG
BB
GGGTT


SS
S
T
 .........150.........160.........170.........180.........190.........200.........210
Sequence DWAPDYDACTWTAQQFHDFLKQYGASLSSTIKIIMPESLGFNPAMSDPTLNDPTTAQYVSIIGGHLYGSP
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) T


SSB

B

STT

GGGTSTT


SSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence IRDYPLARNKGKDIWMTEHYLEGNDPGTCVKLAKEIHDCMTIGNMNAYVYWWISGDQNGLYNTRTNETYK
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)



TT



S

STS

SSSSSTTSSTTTT
T
 .........290.........300.........310.........320.........330.........340.........350
Sequence KTYVMGQFSKFIGNGYSRVDATNSPQSNVYVSAYTGNNKVVIVAINQGTYPVNQSFNVQNSTVSNVSSWV
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TTS
TT

S
SBTTTT
SSS
SS

 .........360.........370.........380.......
Sequence SSGTLNMAKTNSNISAANGRFNASLPAQSVTTFVADA
Predicted secondary structure






















SS confidence




































Known secondary structure (DSSP) SSS
SS






BTT
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D