Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ck1A_

Fold library idPDB HeaderMoleculeTitle
c5ck1A_1.84PDB header: mucin-binding proteinChain: A: PDB Molecule: susd homolog;


Added to library: Thu Feb 9 14:18:07 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RALGFLYSCYGGVSTDLPSAYLGEINSTTDEYVLPYSWNTDGYWGAYAFNTASSTNQDWLWGTTYQYIGQ
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
GGGTTTT
TT
TTSTTTSSSSS

GGGGGSSSTT

BTTBS

 .........80.........90.........100.........110.........120.........130.........140
Sequence CYLFLQKLENAIASDAEKEQWRAECQFLVAYYHFATLRRYGPIPITDSYPTSEYNGRFHFDYCVDWIANQ
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)



SS







GGG





 .........150.........160.........170.........180.........190.........200.........210
Sequence LDEAAKVLPANRWGRATSTIAKAVKARLLLYAASPLWNGSFPYPNWQNENFETPGYGKALVSNTYDKSKW
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) S
S






SGGGTT

S
TT
B
SS

BTTTBTB
S

S

T
 .........220.........230.........240.........250.........260.........270.........280
Sequence ERALAACQEALTLATTSGDRELYDDDEYYSRQSLNLPFVPGVADVEDNKEFLKNVXKXRYAVSTRESEGN
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) TTT








TT




BTTB
SSGGGTS

GGGT
 .........290.........300.........310.........320.........330.........340.........350
Sequence KEIIWGLSNQFDFYSRYPLRILKKSDGTWHAGYSGVSPTLYTFEHFYTANGKLPEKDLDFTPSSEWFESA
Predicted secondary structure




























































SS confidence





































































Known secondary structure (DSSP)

S



STTTS
S
TTS






S
BTTSS
TTT
TTS

GGGTTSB
 .........360.........370.........380.........390.........400.........410.........420
Sequence GISSREDIIKLNVGREPRFYAWXAFDGGDYGTKFAAGSPLKLEXRNSEXHGYNPSLFNRDHSVTGFLTQK
Predicted secondary structure





























































SS confidence





































































Known secondary structure (DSSP)

TT
TT
BGGGSSB
TTSTT

TT
TTTTS

TTSGGG


SSS
T
 .........430.........440.........450.........460.........470.........480.........490
Sequence FVDPVTEFYTAGGSTSGTSAPTILFRLAELYLNVAECHAALGNTQEAIDALNPVRERAGIPKLTLADITN
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) T

TT

TTS


S


T
TTS



GGG

S
 .........500.........510.........520.........530.........540.........550.........560
Sequence NXTIKDWVHNERFVELWNEGHRFFDVRRWAEGAKYFGANKREGLNAEVQSPTFEEFNKRTTVDAPYVWEN
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) SS
TTTTT
TT
STT


S
SSSS

SS


S




G
 .........570.........580....
Sequence RXYLNPVFYNEVYKNPQXVQAPGY
Predicted secondary structure














SS confidence























Known secondary structure (DSSP) GGGS




TT



TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D