Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4om3D_

Fold library idPDB HeaderMoleculeTitle
c4om3D_PDB header: transcription, dna bindingChain: D: PDB Molecule: transducin-like enhancer protein 1;PDBTitle: crystal structure of human tle1 q-domain residues 20-156


Added to library: Sat Apr 12 08:18:23 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTIC
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP)

S
 .........80.........90.........100.........110.........120..
Sequence AQVIPFLSQEHQQQVAQAVERAKQVTMAELNAIIGQQQLQAQHLHGHGPPVP
Predicted secondary structure









SS confidence



















































Known secondary structure (DSSP) GGGS
T


S






SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D